1,494,309+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

Professional job seekers finding India jobs through Expertini
750,000+ professionals on Expertini 750,000+ Candidates
Join our global community
Expertini Penguin Mascot Resume Score™
Resume Score™ Instantly
Upload Your CV
Quick 30-second process

Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.

Reset

Create Job Alert

 
   
Reset

Full Stack Developer I

Responsible for collaborating with advisors to define solution designs, developing scalable and high-performing code, ensuring code quality and security, leading code reviews, managing priorities, facilitating cross-team communication, acting as a demo content owner, mentoring junior developers, and supportin ...

Java Full stack Developer

Java Full stack Developer | Chennai Function - Product Engineering and Development - Non Banking Requirements / Responsibilities: • Should have 8 years of experience as Java developer • Strong knowledge in Java / J2EE, Spring, Spring Boot, Microserv ...

Sr. Full Stack Developer

About this opportunity As a Sr. Full Stack Developer, you will work with a cross-functional agile team. Support existed and create new functionality from scratch, participate in architecture discussions, develop web applications following the up-to-date web standards, APIs and integration ...

.Net Full stack Lead

Job Title: .Net Full stack Lead – (.NET Core, ReactJS, Azure) Experience Required: 7–12 YearsLocation: Hyderabad Role Overview We are seeking a highly skilled and experienced Technical Lead </str ...

Lead Full Stack Engineer

About Us: We ae a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...

.NET Full stack developer

• 10+ years in development Software solutions • Expert working knowledge of C# and .Net • Expert database skills within any RDBMS systems, primarily SQL Server • Experience in web development, mostly with SPA frameworks angular and angular JS, JavaScript, NBC, soap/rest web services • Financi ...

Java Full Stack NCT

Description HR IT, a global technology group of Deutsche Bank’s technology organization, is responsible for all Human Resources IT services and ensures that all HR services and Products are delivered in high quality. Our globally oriented and highly motivated team provide unique benefi ...

Java Full stack developer

Job Description: Minimum Qualification: B.E. or Diploma in Electronics/Electrical and Computer Science/Engineering or similar field from an accredited university with minimum 4-10 years of relevant experience Must have Java Proficiency: strong command ...

Full Stack Python Developer

Role Title: Full Stack Python Developer Location: Bangalore, India — or fully remote for exceptional candidates. Employment Type: Full-Time (Onsite, Hybrid, or Remote options available) Reports to: Head of IT & Engineering from ...

Developer, FUSE Full Stack

Do you want to help solve the world's most pressing challenges? Feeding the world's growing population and slowing climate change are two of the world's greatest challenges. AGCO is a part of the solution! Join us to make your contribution. AGCO is looking to hire candidates for the position of Devel ...

Senior Full Stack Developer

Job Title: Senior Full Stack Developer Job Type: Permanent Experience: Minimum 6 years of relevant experience Location: Hyderabad Job Brief We are lookin ...

Full Stack Developer (React)

We are seeking a driven and detail-oriented Full Stack Developer with 2+ years of experience to join our engineering team. You will be an integral part of the entire software development life cycle—from system design and coding to testing and deployment. In this role, you will build high-quality, responsive, ...

Remote Full Stack Developer

We are seeking a highly skilled Full-Stack Developer to join our dynamic and growing team. If you're passionate about the latest web technologies and have a keen eye for detail, then we want to hear from you. Responsibilities: Design and development of robust, s ...

Engineering Manager Full Stack

Role: Full Stack Developer Experience: 8+ years Location: Chennai Immediate to 30 days We are seeking an experienced Full Stack Developer with 8+ years of ...

React Full stack Engineer

React Full-stack EngineerReact, C#, .NET, REST API Development, Azure Resources, SQL & NoSQLEnglish Communication, Unit Testing, Travel Ecosystem Knowledge (Plus)Senior 10+ Years ...

Lead Full Stack Engineer

About Us: We are a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, w ...

Full stack Python consultant

• 5+ Years relevant software development experience, with a Full Stack profile (Experience in front-end, backend, Integration, cloud automation, and orchestration) • Proficient in Functional & Object-Oriented Programming, Design Patterns with expertise in various cloud-native technologies (C++, Python, C#, ...

Full Stack consultant Ruby

• 3-4 years of Experience with Ruby, Ruby on Rails, along with other standard libraries such as RSpec, Sidekiq, and Grape • Familiarity with PostgreSQL • Familiarity with continuous integration • A knack for writing clean, readable Ruby code • GIT, Github • Ability to work with the unst ...

Procurement Full Stack Developer

JOB DESCRIPTION At Zimmer Biomet, we believe in pushing the boundaries of innovation and driving our mission forward. As a global medical technology leader for nearly 100 years, a patient’s mobility is enhanced by a Zimmer Biomet product or technology every 8 seconds. As a Zimmer Biomet team member, y ...

Full Stack Developer Lead

• 4-6 years of proven IT Experience • Full-Stack Development Expertise • Minimum, one year Javascript, proven Experience • Excellent in Java Springboot JavaScript and OOP JavaScript TypeScript ES6 • Proficient in web development • Java Springboot HTML CSS JavaScript Typescript • Sol ...

Full Stack Systems Developer

About Us: We are a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...

Full Stack Developer Senior

Company: Dandelion Tech Location: Surat / Remote Type: Full-time About Dandelion Tech: At Dandelion Tech, we transform innovative ideas into robust digital solutions. Specializing in web and app ...

Senior Full Stack Developer

Overview We are seeking a skilled Senior Full Stack Developer with strong full-stack development experience. This role is responsible for end-to-end development of scalable, cloud-native applications, spanning both backend and frontend layers. The ideal candidate will bring hands-on expertise ...

Sr. Full Stack Developer

About this opportunity As a Senior Full Stack Developer, you will work with a cross-functional agile team. Support existed and create new functionality from scratch, participate in architecture discussions, develop web applications following the up-to-date web standards, APIs and integrat ...

Lead Full Stack Developer

CDM Smith is seeking a Full Stack Application Developer to join our Digital Engineering Solutions team. This individual will be part of the Development group within the Digital Engineering Solutions team, helping design and implementation of cloud-based solutions facilitating CI/CD practices, and ...

java Full Stack Developer

java Full Stack Developer - CREQ Description Full Stack Developer Resource should be having 3 years of knowledge or experience working in Banking Domain Should have strong understanding of SDLC Must have excellent analytical Skills Good knowledge of Angular, Java, Oracle SQL Must have ...

Python Full Stack Developer

We are looking for a skilled Python Full Stack Developer with experience in Django and React.js to develop and maintain scalable web applications. The ideal candidate should have strong backend and frontend development expertise with a good understanding of REST APIs, databases, and responsive UI development. ...

Java Full Stack Developer

Smart Ship Hub Digital Singapore | Japan | India Smart Ship Hub is seeking a seasoned Technical Architect to lead and scale multiple platform components. This role requires a hands-on leader with deep expertise in backend and front ...

Senior Full Stack Developer

Description Backend - Must haves: Typescript + NestJS preferably or any MVC framework with Express on Node and DB skills Nice to have: AWS Front end - Must haves: Typescript + NextJS or React < ...

Technical Lead Full Stack

SOLIZE PARTNERS India Private Limited Job Title: Technical Lead Job Location: Bangalore Employment Type: Full Time, Permanent Experience: 8+ Years Educational Qualifi ...

Technical Lead Full Stack

SOLIZE PARTNERS India Private LimitedJob Title: Technical LeadJob Location: BangaloreEmployment Type: Full Time, PermanentExperience: 8+ YearsEducational Qualification:</s ...

Director, Technology (Full Stack)

About AffinityAffinity is pioneering new frontiers in AdTech by building privacy-first advertising infrastructure that helps publishers maximize monetization and enables advertisers to reach the right audiences beyond walled gardens. Operating across 10+ markets in Asia, the US, and Europe, with a team of 65 ...

GIS Full Stack Developer

Dar Al-Handasah (Shair and Partners) is a renowned multidisciplinary consultancy firm specializing in Architecture, Engineering, Planning, and Environmental Design. With a legacy of over 60 years, we have a global presence and a commitment to delivering innovative and sustainable solutions to our clients' mos ...

.Net Full Stack Developer

- Design, develop, and maintain scalable backend applications using Node.Js. - Collaborate with cross-functional teams to gather requirements and translate them into technical specifications and solutions. - Build and maintain RESTful APIs and microservices-based architecture for enterprise applicati ...

Aem Full Stack Professional

- Build scalable components, templates, workflows, and integrations using AEM - Implement full stack features across front-end and back-end technologies - Develop custom solutions using Java, Apache Sling, OSGi, CRX/JCR, and HTL/Sightly - Create responsive UI from UX/UI designs using HTML5, CSS3, JavaScript, and ...

Full Stack Application Engineer

The Drop Times is looking for a Social Media Manager (0–1 year experience) to help grow and engage our global audience across technology and open-source communities.This role is ideal for someone who understands digital conversations, enjoys building communities, and can create platform-sp ...

Full stack Development Lead

ABOUT TRICOGTricog is a healthcare technology, product-based company headquartered in Bangalore. We build predictive and virtual diagnostic solutions for cardiovascular diseases, enabling clinicians to make faster, more accurate decisions that save lives.Our software directly su ...

Technical Lead Full Stack

SOLIZE PARTNERS India Private LimitedJob Title:Technical LeadJob Location:BangaloreEmployment Type:Full Time, PermanentExperience:8+ YearsEducational Qualification:• Bachelor’s degree in Computer Science, Engineering, or related field<br/ ...

Full Stack Geoinformatics Specialist

Dar Al-Handasah (Shair and Partners) is a renowned multidisciplinary consultancy firm specializing in Architecture, Engineering, Planning, and Environmental Design. With a legacy of over 60 years, we have a global presence and a commitment to delivering innovative and sustainable solutions to our clients' mos ...

AI Node Full stack

About Position:We are seeking an experienced Senior Software Engineer to design and build scalable, AI-driven payment solutions that power social impact initiatives. This role focuses on developing secure, reliable, and high-performance payment platforms integrated with third-party pr ...

Technical Lead Full Stack

SOLIZE PARTNERS India Private Limited Job Title: Technical Lead Job Location: Bangalore Employment Type: Full Time, Permanent Experience: 8+ Years Educational Qualification: • Bachelor’s degree in Computer Sci ...

Technical Lead Full Stack

SOLIZE PARTNERS India Private Limited Job Title: Technical Lead Job Location: Bangalore Employment Type: Full Time, Permanent Experience: 8+ Years Educational Qualification: • Bachelor’s degree in Computer Sci ...

Director, Technology (Full Stack)

About AffinityAffinity is pioneering new frontiers in AdTech by building privacy-first advertising infrastructure that helps publishers maximize monetization and enables advertisers to reach the right audiences beyond walled gardens. Operating across 10+ markets in Asia, the US, and Europe, with ...

AI Node Full stack

About Position: We are seeking an experienced Senior Software Engineer to design and build scalable, AI-driven payment solutions that power social impact initiatives. This role focuses on developing secure, reliable, and high-performance payment platforms integrated with third-party ...

GIS Full Stack Developer

Dar Al-Handasah (Shair and Partners) is a renowned multidisciplinary consultancy firm specializing in Architecture, Engineering, Planning, and Environmental Design. With a legacy of over 60 years, we have a global presence and a commitment to delivering innovative and sustainable solutions to our clients' most c ...

GIS Full Stack Developer

Dar Al-Handasah (Shair and Partners) is a renowned multidisciplinary consultancy firm specializing in Architecture, Engineering, Planning, and Environmental Design. With a legacy of over 60 years, we have a global presence and a commitment to delivering innovative and sustainable solutions to our clients' mos ...

AI Node Full stack

About Position:We are seeking an experienced Senior Software Engineer to design and build scalable, AI-driven payment solutions that power social impact initiatives. This role focuses on developing secure, reliable, and high-performance payment platforms integrated with third-party pr ...

Director, Technology (Full Stack)

About Affinity Affinity is pioneering new frontiers in AdTech by building privacy-first advertising infrastructure that helps publishers maximize monetization and enables advertisers to reach the right audiences beyond walled gardens. Operating across 10+ markets in Asia, the US, and ...

Full Stack Engineering Instructor

About Newton:Newton School of Technology (NST) is a new-age institution redefining technical education in India. Founded by IIT alumni, NST offers a 4-year B. Tech in Computer Science and AI, focused on hands-on learning and deep industry integration. Within two years, over 93% of stud ...

Technical Lead Full Stack

SOLIZE PARTNERS India Private Limited Job Title: Technical Lead Job Location: Bangalore Employment Type: Full Time, Permanent Experience: 8+ Years Educational Qualifi ...

🚀 Boost Your Hiring Chances with Our AI-Powered Tool-Kit

Stand out from thousands of applicants. Use our proven career tools to optimize your applications and land your dream job faster.

To-Do Planner

Organize your job search and personal tasks. All data is confidential.

Open Planner

Wellbeing Center

Access your confidential wellness report and resources to manage job search stress.

Check Wellbeing

Skill Coach

Plan your skill development with O*NET support to stay competitive in your field.

Start Coaching

Outfit Helper

Get AI-powered suggestions on what to wear for your next interview.

Find Outfit

Income Tax Calculator

Plan your finances with our calculator, updated for 2025 tax regulations.

Calculate Tax

Salary Benchmark

Get accurate, AI-supported salary trends to know your worth and negotiate better.

Check Salaries

Interview Practice

Practice for any interview with AI-enabled Q&A sessions. All data is private.

Start Practicing

Interview Predictor

Use our AI-supported tool to predict potential interview questions based on your resume.

Predict Questions

Interview Practice Timer

Use our mock interview trainer to perfect your answers under timed conditions.

Start Timer

Behavioral Mastery

Ace tricky behavioral interviews with our AI-powered practice module.

Master Answers

Question Journal

Confidentially record interview questions you were asked for future reference.

Open Journal

Interview Ace

A comprehensive tool to help you master every aspect of your interviews.

Become an Ace

Q&A Logs

Confidentially track your answers to common questions and refine them over time.

View Logs

Application Planner

Schedule and organize your job applications in one confidential planner.

Open Planner

Cover Letter Tool

Create perfect, tailored cover letters for each application with AI support.

Generate Letter

Resume Score

Get instant feedback on your resume with our NLP-supported analysis tool.

Check My Score

ATS Score

Check your resume's compatibility with Applicant Tracking Systems (ATS).

Check ATS Score

Application Analyzer

Use AI to analyze job descriptions and optimize your application materials.

Analyze Application

Career Visualizer

Confidentially plan and visualize your long-term career path and goals.

Visualize My Career

Offer Genius

Get intelligent insights and strategies to confidently negotiate job offers.

Negotiate Offers

JobFlow

Track your entire job search progress from application to offer with this intelligent tool.

Track My Flow

JobSense

Our intelligent matching engine that provides smart job recommendations.

Get Smart Matches

Networking Toolkit

Tools to build and manage your professional connections. All data is confidential.

Build Network

Professional CV

A classic, O*NET supported template for corporate and professional roles.

Use This Template

Executive CV

A premium, O*NET supported template designed for senior and C-level positions.

Use This Template

Modern CV

A fresh, stylish, O*NET supported template perfect for tech and modern industries.

Use This Template

Creative CV

A visually distinct, O*NET supported template for design and artistic roles.

Use This Template

Minimalist CV

A clean, simple, O*NET supported template that focuses purely on content.

Use This Template

Europass CV

The standard European Union recommended format for wide compatibility.

Use This Template

Student CV

An institution-recommended template perfect for internships and first jobs.

Use This Template

Graduate CV

An institution-recommended template for recent graduates entering the workforce.

Use This Template

Academic CV

The researcher-recommended format for roles in academia and research.

Use This Template

Developer/IT CV

A tech-savvy recommended template to highlight your technical skills.

Use This Template

Skilled Worker CV

A trades-recommended template to showcase hands-on skills and experience.

Use This Template

Monochrome CV

A sleek, black-and-white, O*NET supported template for a professional look.

Use This Template

Art CV

An artist-recommended template that allows your creativity to shine.

Use This Template

Harvard CV

A researcher-recommended template based on the classic Harvard format.

Use This Template

Volunteer Research

Help us improve our platform by joining our community research program.

Join Research

Review Us

Share your experience with our tools to help other job seekers.

Share Experience

Register

Create your free account to save jobs, build your profile, and track applications.

Create Account

Login

Access your dashboard, manage applications, and continue your job search.

Access Your Account

Profile Builder

Create a comprehensive professional profile that attracts recruiters and showcases your skills.

Build Your Profile

View Profile

See your public profile exactly as employers will see it. Make sure it's perfect.

Preview Profile

Bookmarked Jobs

Keep track of all your saved job opportunities in one organized place.

View Saved Jobs

Your Reviews

View and manage all the company reviews you've submitted.

See Your Reviews

Following

Manage the list of companies you follow to stay updated on their new openings.

Manage Following

Find Companies

Discover and research top employers in your country and industry.

Discover Employers

Standalone CV Builder

Use our O*NET supported CV builder to create a professional resume from scratch.

Build Your CV

PDF to DOC (Beta)

Convert your PDF resumes or documents into editable Word (DOC) format.

Convert PDF

DOC to PDF (Beta)

Create universally compatible PDF documents from your Word (DOC) files.

Create PDF

General FAQ

Find answers to common questions about our job site and platform.

Read FAQ

Job Seekers FAQ

Get help and find answers to questions specifically for job seekers.

Get Help

Job Matching

Learn about the technology and algorithms behind how we match you to jobs.

Learn How

Personalized Matching

Discover how we use your profile and activity to provide customized job suggestions.

Learn More

Quick Apply

Understand our fast application process and how to make the most of it.

Learn More

Alert Frequency

Learn how to manage your job alert settings so you get the updates you want.

Manage Settings

Job Alerts Guide

A complete guide to understanding how job alerts work and how to use them effectively.

Read Guide

Resume Matching

Learn how our system matches your resume to job requirements.

Learn More

Ethical Branding

Read our guide to building a professional and ethical personal brand.

Read Guide

Candidate Visibility

Learn how to increase your visibility to recruiters on our platform.

Increase Visibility

Verified Badge

Find out how you can get a verified badge to build trust with employers.

Get Verified

AI ATS Technology

Learn about the advanced AI and ATS technology that powers our platform.

Learn More

ATS Ranking

Understand how Applicant Tracking Systems rank you as an applicant.

Learn More

Semantic Matching

Learn how our AI-powered semantic matching goes beyond keywords.

Learn More

    Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights