Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.
Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.
Senior Developer ReactJS Full stack
Location: Bangalore out ring road, 3 days mandatory work from office at client location Experience Range 6 - 10 Years Job Type: 6 months contract + ext Need Immediate joiners only <stro ...
Senior Software Engineer Full Stack
Great vacancy Senior Software Engineer hiring now <meta content=AoeiQ3Ow/BnNjoZ1k2kL0ix9SXzlnjm47YFisfuVAskKVTny0NGo4CEkVQNe1OCi48F77X4EZc6G69wDDJtAlggAAABleyJvcmlnaW4iOiJodHRwczovL3NhbGVzZm9yY2Utc2l0ZXMuY29tOjQ0MyIsImZ ...
Beacon.li Senior Full Stack Engineer
Job Description: SDE3 / Principal Engineer Location: On-Site Hyderabad About the Role:We are seeking a highly skilled SDE3 / Principal Engineer to join our dynamic engineering team. This is not a role for someo ...
Atlassian Full Stack Forge Developer
Are you ready to power the future? At SolarEdge (NASDAQ: SEDG), we're a global leader in smart energy technology, with over 4,000 employees, offices in 34 countries, and millions of installations worldwide. Our innovative solutions include solar inverters, battery storage, ba ...
Software Engineer Full Stack Java
Who We Are At Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ...
Java Full Stack(Angular) Developer
Summary The Senior Java/Angular Developer participates in the full development life cycle of business software including design, development, unit/load testing, deployment and maintenance of a software system and implementation of business software for the enterprise. Provides e ...
Senior Full Stack Developer MERN
Requirement Details are below: Title: Senior Full Stack Developer Banking Domain Location: Thousand Lights, Chennai Work Mode: Onsite (5 Days) | Sat/Sun Week Off Department: Software Development Positions: 1 Employment Type: Full Time Remote: No </ ...
Principal Full Stack UI Developer
About Netskope Today, there's more data and users outside the enterprise than inside, causing the network perimeter as we know it to dissolve. We realized a new perimeter was needed, one that is built in the cloud and follows and protects data wherever it goes, so we started Net ...
ShimentoX Technologies Full Stack Developer
Full Stack Developer Job Location: Gurgaon Work Mode: 5 days Onsite Java, Spring Boot, Angular or ReactJS, AWS or Azure Cloud, REST APIsJavaScript / T ...
Tätigkeitsbereich:IT/TelekommunikationFachabteilung:SW Release Management-1Gesellschaft:Mercedes-Benz Research and Development India Private LimitedStandort:Mercedes-Benz Research and Development India Private Limited, BangaloreStartdatum:sofortVeröffentlichungsdatum:..6Stellennummer:MER3YMQArbeitszeit:Vollzeit ...
Senior Full Stack Developer PHP
About the company Lexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success. Lexitas offers an array of services ...
Java Full Stack Vice President
Engineering Lead You should be required to be proficient in Java/J2EE tech stack. Must have expertise in “Agile” Software development methodology. Good hands-on designing and development using SOLID Design principles. Exposure to new age tech ...
Senior Technical Lead(Full Stack)
About Taglynk At Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world ...
Senior Full Stack Developer PHP
About the company Lexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success. Lexitas offers an array of services including local and national court r ...
Java Full Stack Developer Officer
Job Title Software Engineering & Development - Java Full Stack, Officer Role Summary & Role Description Java Full Stack Developer will contribute to the development, enhancement and maintenance of financial applications as a member of an agile scrum team. This is a ...
About Company: It is a data and analytics company Experience: 3 to 8Years Location: Bangalore Title: Python Developer Notice Period: Immediate to 30 Days </p ...
Senior Software Engineer Full Stack
Company Overview Docusign brings agreements to life. Over 1.5 million customers and more than a billion people in over 180 countries use Docusign solutions to accelerate the process of doing business and simplify people’s lives. With intelligent agreement management, Docusign unleashes business-critical data tha ...
Senior Architect (Full Stack + AWS)
Senior Architect (Full Stack + AWS) | EY GDS | Hyderabad We are urgently hiring for EY Global Delivery Services (EY GDS) for a highly experienced Senior Architect (Full Stack + AWS) role in Hyderabad. Role: Senior Architect (Full Stack + AWS) Experi ...
Senior Full Stack Developer (MEAN)
Candidate should be able to: design and present solutions that conform to the banks technology strategy and road map. oversee the execution of designed solutions by the development team. create build/package scripts for deploying applications using GitHub, Jenkins, Artifactory, and Ansible. ...
Senior technical lead(full stack)
About TaglynkAt Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world-class leaders ...
Full Stack Developer (Node.js & React.js)
Job Summary Synechron is seeking a skilled Full Stack Developer with extensive experience in Node.js and React.js to support the development of scalable, high-performance enterprise applications. This role involves designing, developing, and maintaining robust front-end and back-end systems, integ ...
Java Full Stack/ Consultant Specialist
Some careers shine brighter than others. If you’re looking for a career that will help you stand out, join HSBC and fulfil your potential. Whether you want a career that could take you to the top, or simply take you in an exciting new direction, HSBC offers opportunities, support and rewards that will ...
Senior Software Engineer Full stack
Senior Software Engineer - Full stack Location: Noida, UP, IN BCR (Barco Control Rooms) The Barco Control Rooms business unit is making workflow and visualization solutions for the Control Room market since to help operators collect, visualize and share c ...
Technical Lead Java Full Stack
Position Description: Company Profile:Founded in , CGI is among the largest independent IT and business consulting services firms in the world. With 94, consultants and professionals across the globe, CGI delivers an end-to-end portfolio of capabilities, from strategic IT and busi ...
Senior Full Stack Software Engineer
Job DescriptionWe are looking for a talented Senior Full Stack Engineer to join our growing global team at Sectigo. We are hiring a backend-leaning Senior Full-Stack Software Engineer to help build, test, and operate a modern SaaS platform spanning Perl, Go, and TypeScript/Vue services. The p ...
Node + React Full Stack Developer
Job Title: Full Stack Developer (React + Node.js + AWS) Experience: 7–10 YearsLocation: Bangalore / Pune Job Summary: We are seeking an experienced Full Stack Developer with strong expertise in React.js, Node.js, and AWS to design, develop, and maintai ...
Full Stack Developer(Java+ Angular)
This role is for one of the Weekday's clients Salary range: Rs - Rs (ie INR 12-16 LPA) Min Experience: 7 years Location: Pune, Bengaluru, Chennai, Coimbatore JobType: full-time We are seeking a skilled Java Full Stack Developer with ...
Full Stack Software Engineer GenAI
We are seeking a Full Stack Software Engineer with strong expertise in Node.js, React.js, and Generative AI integrations . You will be responsible for building scalable digital products and embedding AI-driven capabilities into applications. Key Responsibili ...
Full Stack JS Developer (MERN)
About Us: We ae a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...
Software Engineer Full Stack Development
Who We Are At Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ...
Staff Java Engineer Full Stack
Job Description Architect, design, and develop scalable, high-performance backend systems using Java and AWS. Build and maintain cloud-native microservices and API-driven platforms (REST/GraphQL). Contribute to end-to-end solution design across backend services and fr ...
CRM Integration Engineer (Full Stack)
About Us: We ae a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...
Principal Full stack AI Engineer
Job Title: Principal Full Stack AI Engineer Job Location: WFH/Remote / Preference Gurugram Reporting By: Team of Developers Experience: 8+ years 8+ years of work experience with JavaScript 8+ ...
Senior Technical Lead(Full Stack)
About Taglynk At Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world-class leaders wit ...
Full Stack TypeScript Tech Lead
Description :Responsibilities 1. Act as the senior technical authority in the team, specializing in backend development with TypeScript and Node.js, while also possessing a solid understanding of full-stack development principles.2. Work in close partnership with the Scrum ...
Principal Consultant, Full stack Developer
Ready to shape the future of work? At Genpact, we don’t just adapt to change—we drive it. AI and digital innovation are redefining industries, and we’re leading the charge. Genpact’s AI Gigafactory, our industry-first accelerator, is an example of how we’re scaling advanced technology solutions to he ...
Senior Java Full Stack Developer
Let’s be #BrilliantTogether ISS STOXX is actively hiring for a Senior Java Full Stack Developer to join ourteam in Mumbai (Goregaon East), India. Overview: As a Senior Java Full Stack Developer at ISS STOXX, you will play a key role in designing, implementing, and ...
Tech Lead (Full Stack Developer)
Company Overview Twixor is a Singapore-headquartered IT Services and IT Consulting company transforming customer engagements through intelligent business process automation over messaging channels. Serving a global client base, including Fortune 500 companies, Twixor delivers digital ...
Fold Health Full Stack Developer
Job Title: Full Stack Developer Experience: 3+ years Location: Pune (Amar Tech Park, Balewadi, Pune) – Full-time, On-site Domain: Healthcare (Preferred) About Fold Health Fold Health is building a ...
Java Full Stack(Angular) Developer
Summary The Senior Java/Angular Developer participates in the full development life cycle of business software including design, development, unit/load testing, deployment and maintenance of a software system and implementation of business software for the enterprise. Provides expertise in one or more ...
Principal Java Full Stack Engineer
Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benefits, data and resources they need to feel their best. Here, you will fin ...
Senior Full Stack Developer (CORE)
We are looking for an experienced Senior Full Stack Developer who can handle both front-end and back-end development, contribute to API integrations, and mentor junior developers. This is a fully remote position. Job Responsibilities Build and maintain scalable web applic ...
Senior Full Stack Engineer (Backend)
Job description We are seeking a talented Senior Full Stack Engineer (Backend) to develop backend solutions using TypeScript and JavaScript, contributing to our AI Factory products. The role involves working alongside cross-functional teams to develop robust backend services that suppo ...
Full Stack Front End Developer
We are looking for an experienced Full Stack Front-End Developer to lead the development and maintenance of our cutting-edge applications built on the MERN (MongoDB, Express.js, React, Node.js) stack.Job Description: Responsibilities: Front-End Development Excellence: </p ...
Software Engineer Full Stack Java
Who We Are At Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ...
Full Stack Front End Developer
We are looking for an experienced Full Stack Front-End Developer to lead the development and maintenance of our cutting-edge applications built on the MERN (MongoDB, Express.js, React, Node.js) stack.Job Description: Responsibilities: Front-End Development Excellence: </p ...
Raven: Full stack Engineer Role
Raven is a YC-backed startup (S22) building AI assistants for manufacturing plants. We're taking decades of manufacturing expertise and combining it with AI to solve real operational problems. Backed by top VCs, we're a small, focused team working to make industrial operations safer, smarter, and more efficie ...
Senior Full Stack (node.js) Engine...
Candidate should be able to: Design and develop microservices using node.js. Participate in agile development processes in SDLC, including sprint planning, iterative development, estimations, and design sessions Communicate effectively across desks, teams, and departments Develop clean, mo ...
Stand out from thousands of applicants. Use our proven career tools to optimize your applications and land your dream job faster.
Organize your job search and personal tasks. All data is confidential.
Open Planner →Access your confidential wellness report and resources to manage job search stress.
Check Wellbeing →Plan your skill development with O*NET support to stay competitive in your field.
Start Coaching →Get AI-powered suggestions on what to wear for your next interview.
Find Outfit →Plan your finances with our calculator, updated for 2025 tax regulations.
Calculate Tax →Get accurate, AI-supported salary trends to know your worth and negotiate better.
Check Salaries →Practice for any interview with AI-enabled Q&A sessions. All data is private.
Start Practicing →Use our AI-supported tool to predict potential interview questions based on your resume.
Predict Questions →Use our mock interview trainer to perfect your answers under timed conditions.
Start Timer →Ace tricky behavioral interviews with our AI-powered practice module.
Master Answers →Confidentially record interview questions you were asked for future reference.
Open Journal →A comprehensive tool to help you master every aspect of your interviews.
Become an Ace →Confidentially track your answers to common questions and refine them over time.
View Logs →Schedule and organize your job applications in one confidential planner.
Open Planner →Create perfect, tailored cover letters for each application with AI support.
Generate Letter →Get instant feedback on your resume with our NLP-supported analysis tool.
Check My Score →Check your resume's compatibility with Applicant Tracking Systems (ATS).
Check ATS Score →Use AI to analyze job descriptions and optimize your application materials.
Analyze Application →Confidentially plan and visualize your long-term career path and goals.
Visualize My Career →Get intelligent insights and strategies to confidently negotiate job offers.
Negotiate Offers →Track your entire job search progress from application to offer with this intelligent tool.
Track My Flow →Our intelligent matching engine that provides smart job recommendations.
Get Smart Matches →Tools to build and manage your professional connections. All data is confidential.
Build Network →A classic, O*NET supported template for corporate and professional roles.
Use This Template →A premium, O*NET supported template designed for senior and C-level positions.
Use This Template →A fresh, stylish, O*NET supported template perfect for tech and modern industries.
Use This Template →A visually distinct, O*NET supported template for design and artistic roles.
Use This Template →A clean, simple, O*NET supported template that focuses purely on content.
Use This Template →The standard European Union recommended format for wide compatibility.
Use This Template →An institution-recommended template perfect for internships and first jobs.
Use This Template →An institution-recommended template for recent graduates entering the workforce.
Use This Template →The researcher-recommended format for roles in academia and research.
Use This Template →A tech-savvy recommended template to highlight your technical skills.
Use This Template →A trades-recommended template to showcase hands-on skills and experience.
Use This Template →A sleek, black-and-white, O*NET supported template for a professional look.
Use This Template →An artist-recommended template that allows your creativity to shine.
Use This Template →A researcher-recommended template based on the classic Harvard format.
Use This Template →Help us improve our platform by joining our community research program.
Join Research →Share your experience with our tools to help other job seekers.
Share Experience →Create your free account to save jobs, build your profile, and track applications.
Create Account →Access your dashboard, manage applications, and continue your job search.
Access Your Account →Create a comprehensive professional profile that attracts recruiters and showcases your skills.
Build Your Profile →See your public profile exactly as employers will see it. Make sure it's perfect.
Preview Profile →Keep track of all your saved job opportunities in one organized place.
View Saved Jobs →View and manage all the company reviews you've submitted.
See Your Reviews →Manage the list of companies you follow to stay updated on their new openings.
Manage Following →Discover and research top employers in your country and industry.
Discover Employers →Use our O*NET supported CV builder to create a professional resume from scratch.
Build Your CV →Convert your PDF resumes or documents into editable Word (DOC) format.
Convert PDF →Create universally compatible PDF documents from your Word (DOC) files.
Create PDF →Find answers to common questions about our job site and platform.
Read FAQ →Get help and find answers to questions specifically for job seekers.
Get Help →Learn about the technology and algorithms behind how we match you to jobs.
Learn How →Discover how we use your profile and activity to provide customized job suggestions.
Learn More →Understand our fast application process and how to make the most of it.
Learn More →Learn how to manage your job alert settings so you get the updates you want.
Manage Settings →A complete guide to understanding how job alerts work and how to use them effectively.
Read Guide →Learn how our system matches your resume to job requirements.
Learn More →Read our guide to building a professional and ethical personal brand.
Read Guide →Learn how to increase your visibility to recruiters on our platform.
Increase Visibility →Find out how you can get a verified badge to build trust with employers.
Get Verified →Learn about the advanced AI and ATS technology that powers our platform.
Learn More →Understand how Applicant Tracking Systems rank you as an applicant.
Learn More →Learn how our AI-powered semantic matching goes beyond keywords.
Learn More →Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights
Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph uses a vertical bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each vertical bar represents a different job category, with the size of the vertical bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph uses a funnel chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the funnel represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,494,396+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
There are popular job portals and recruitment agencies active in India. India Jobs Expertini is one of the major portals that can help you find the right job. Expertini.Com can assist you in accessing a wide range of job listings and professional opportunities, in addition to its free CV Builder, Resume Score, and Job Alert tools.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.