1,494,396+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

Professional job seekers finding India jobs through Expertini
750,000+ professionals on Expertini 750,000+ Candidates
Join our global community
Expertini Penguin Mascot Resume Score™
Resume Score™ Instantly
Upload Your CV
Quick 30-second process

Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.

Reset

Create Job Alert

 
   
Reset

Senior Developer ReactJS Full stack

Location: Bangalore out ring road, 3 days mandatory work from office at client location Experience Range 6 - 10 Years Job Type: 6 months contract + ext Need Immediate joiners only <stro ...

Senior Software Engineer Full Stack

Great vacancy Senior Software Engineer hiring now <meta content=AoeiQ3Ow/BnNjoZ1k2kL0ix9SXzlnjm47YFisfuVAskKVTny0NGo4CEkVQNe1OCi48F77X4EZc6G69wDDJtAlggAAABleyJvcmlnaW4iOiJodHRwczovL3NhbGVzZm9yY2Utc2l0ZXMuY29tOjQ0MyIsImZ ...

Beacon.li Senior Full Stack Engineer

Job Description: SDE3 / Principal Engineer Location: On-Site Hyderabad About the Role:We are seeking a highly skilled SDE3 / Principal Engineer to join our dynamic engineering team. This is not a role for someo ...

Atlassian Full Stack Forge Developer

Are you ready to power the future? At SolarEdge (NASDAQ: SEDG), we're a global leader in smart energy technology, with over 4,000 employees, offices in 34 countries, and millions of installations worldwide. Our innovative solutions include solar inverters, battery storage, ba ...

Software Engineer Full Stack Java

Who We Are At Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ...

Java Full Stack(Angular) Developer

Summary The Senior Java/Angular Developer participates in the full development life cycle of business software including design, development, unit/load testing, deployment and maintenance of a software system and implementation of business software for the enterprise. Provides e ...

Senior Full Stack Developer MERN

Requirement Details are below: Title: Senior Full Stack Developer Banking Domain Location: Thousand Lights, Chennai Work Mode: Onsite (5 Days) | Sat/Sun Week Off Department: Software Development Positions: 1 Employment Type: Full Time Remote: No </ ...

Principal Full Stack UI Developer

About Netskope Today, there's more data and users outside the enterprise than inside, causing the network perimeter as we know it to dissolve. We realized a new perimeter was needed, one that is built in the cloud and follows and protects data wherever it goes, so we started Net ...

ShimentoX Technologies Full Stack Developer

Full Stack Developer Job Location: Gurgaon Work Mode: 5 days Onsite Java, Spring Boot, Angular or ReactJS, AWS or Azure Cloud, REST APIsJavaScript / T ...

Full stack Developer Java/Vue

Tätigkeitsbereich:IT/TelekommunikationFachabteilung:SW Release Management-1Gesellschaft:Mercedes-Benz Research and Development India Private LimitedStandort:Mercedes-Benz Research and Development India Private Limited, BangaloreStartdatum:sofortVeröffentlichungsdatum:..6Stellennummer:MER3YMQArbeitszeit:Vollzeit ...

Senior Full Stack Developer PHP

About the company Lexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success. Lexitas offers an array of services ...

Java Full Stack Vice President

Engineering Lead You should be required to be proficient in Java/J2EE tech stack. Must have expertise in “Agile” Software development methodology. Good hands-on designing and development using SOLID Design principles. Exposure to new age tech ...

Senior Technical Lead(Full Stack)

About Taglynk At Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world ...

Senior Full Stack Developer PHP

About the company Lexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success. Lexitas offers an array of services including local and national court r ...

Java Full Stack Developer Officer

Job Title Software Engineering & Development - Java Full Stack, Officer Role Summary & Role Description Java Full Stack Developer will contribute to the development, enhancement and maintenance of financial applications as a member of an agile scrum team. This is a ...

Lead Full Stack ML Platforms

About Company: It is a data and analytics company Experience: 3 to 8Years Location: Bangalore Title: Python Developer Notice Period: Immediate to 30 Days </p ...

Senior Software Engineer Full Stack

Company Overview Docusign brings agreements to life. Over 1.5 million customers and more than a billion people in over 180 countries use Docusign solutions to accelerate the process of doing business and simplify people’s lives. With intelligent agreement management, Docusign unleashes business-critical data tha ...

Senior Architect (Full Stack + AWS)

Senior Architect (Full Stack + AWS) | EY GDS | Hyderabad We are urgently hiring for EY Global Delivery Services (EY GDS) for a highly experienced Senior Architect (Full Stack + AWS) role in Hyderabad. Role: Senior Architect (Full Stack + AWS) Experi ...

Senior Full Stack Developer (MEAN)

Candidate should be able to: design and present solutions that conform to the banks technology strategy and road map. oversee the execution of designed solutions by the development team. create build/package scripts for deploying applications using GitHub, Jenkins, Artifactory, and Ansible. ...

Senior technical lead(full stack)

About TaglynkAt Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world-class leaders ...

Full Stack Developer (Node.js & React.js)

Job Summary Synechron is seeking a skilled Full Stack Developer with extensive experience in Node.js and React.js to support the development of scalable, high-performance enterprise applications. This role involves designing, developing, and maintaining robust front-end and back-end systems, integ ...

Java Full Stack/ Consultant Specialist

Some careers shine brighter than others. If you’re looking for a career that will help you stand out, join HSBC and fulfil your potential. Whether you want a career that could take you to the top, or simply take you in an exciting new direction, HSBC offers opportunities, support and rewards that will ...

Senior Software Engineer Full stack

Senior Software Engineer - Full stack Location: Noida, UP, IN ​​BCR (Barco Control Rooms) The Barco Control Rooms business unit is making workflow and visualization solutions for the Control Room market since to help operators collect, visualize and share c ...

Technical Lead Java Full Stack

Position Description: Company Profile:Founded in , CGI is among the largest independent IT and business consulting services firms in the world. With 94, consultants and professionals across the globe, CGI delivers an end-to-end portfolio of capabilities, from strategic IT and busi ...

Senior Full Stack Software Engineer

Job DescriptionWe are looking for a talented Senior Full Stack Engineer to join our growing global team at Sectigo. We are hiring a backend-leaning Senior Full-Stack Software Engineer to help build, test, and operate a modern SaaS platform spanning Perl, Go, and TypeScript/Vue services. The p ...

Node + React Full Stack Developer

Job Title: Full Stack Developer (React + Node.js + AWS) Experience: 7–10 YearsLocation: Bangalore / Pune Job Summary: We are seeking an experienced Full Stack Developer with strong expertise in React.js, Node.js, and AWS to design, develop, and maintai ...

Full Stack Developer(Java+ Angular)

This role is for one of the Weekday's clients Salary range: Rs - Rs (ie INR 12-16 LPA) Min Experience: 7 years Location: Pune, Bengaluru, Chennai, Coimbatore JobType: full-time We are seeking a skilled Java Full Stack Developer with ...

Full Stack Software Engineer GenAI

We are seeking a Full Stack Software Engineer with strong expertise in Node.js, React.js, and Generative AI integrations . You will be responsible for building scalable digital products and embedding AI-driven capabilities into applications. Key Responsibili ...

Full Stack JS Developer (MERN)

About Us: We ae a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...

Software Engineer Full Stack Development

Who We Are At Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ...

Staff Java Engineer Full Stack

Job Description Architect, design, and develop scalable, high-performance backend systems using Java and AWS. Build and maintain cloud-native microservices and API-driven platforms (REST/GraphQL). Contribute to end-to-end solution design across backend services and fr ...

CRM Integration Engineer (Full Stack)

About Us: We ae a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...

Principal Full stack AI Engineer

Job Title: Principal Full Stack AI Engineer Job Location: WFH/Remote / Preference Gurugram Reporting By: Team of Developers Experience: 8+ years 8+ years of work experience with JavaScript 8+ ...

Senior Technical Lead(Full Stack)

About Taglynk At Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world-class leaders wit ...

Full Stack TypeScript Tech Lead

Description :Responsibilities 1. Act as the senior technical authority in the team, specializing in backend development with TypeScript and Node.js, while also possessing a solid understanding of full-stack development principles.2. Work in close partnership with the Scrum ...

Principal Consultant, Full stack Developer

Ready to shape the future of work? At Genpact, we don’t just adapt to change—we drive it. AI and digital innovation are redefining industries, and we’re leading the charge. Genpact’s AI Gigafactory, our industry-first accelerator, is an example of how we’re scaling advanced technology solutions to he ...

Senior Java Full Stack Developer

Let’s be #BrilliantTogether ISS STOXX is actively hiring for a Senior Java Full Stack Developer to join ourteam in Mumbai (Goregaon East), India. Overview: As a Senior Java Full Stack Developer at ISS STOXX, you will play a key role in designing, implementing, and ...

Tech Lead (Full Stack Developer)

Company Overview Twixor is a Singapore-headquartered IT Services and IT Consulting company transforming customer engagements through intelligent business process automation over messaging channels. Serving a global client base, including Fortune 500 companies, Twixor delivers digital ...

Java Full Stack QC Specialist

Description : Overview: The Java Full Stack Specialist evaluates learners’ technical proficiency in full-stack development, provides mentorship, and ensures alignment with industry standards. This role involves comprehensive assessment across Java, backend frameworks, front ...

Fold Health Full Stack Developer

Job Title: Full Stack Developer Experience: 3+ years Location: Pune (Amar Tech Park, Balewadi, Pune) – Full-time, On-site Domain: Healthcare (Preferred) About Fold Health Fold Health is building a ...

Java Full Stack(Angular) Developer

Summary The Senior Java/Angular Developer participates in the full development life cycle of business software including design, development, unit/load testing, deployment and maintenance of a software system and implementation of business software for the enterprise. Provides expertise in one or more ...

Principal Java Full Stack Engineer

Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benefits, data and resources they need to feel their best. Here, you will fin ...

Senior Full Stack Developer (CORE)

We are looking for an experienced Senior Full Stack Developer who can handle both front-end and back-end development, contribute to API integrations, and mentor junior developers. This is a fully remote position. Job Responsibilities Build and maintain scalable web applic ...

Senior Full Stack Engineer (Backend)

Job description We are seeking a talented Senior Full Stack Engineer (Backend) to develop backend solutions using TypeScript and JavaScript, contributing to our AI Factory products. The role involves working alongside cross-functional teams to develop robust backend services that suppo ...

Full Stack Lead Engineer(C#)

Job Description – Full Stack Lead Engineer (C#) Location: Hyderabad Work Module: Work From Office Experience: 8+ Years Employment Type: Full-Time Company Overview At Codvo, software and peo ...

Full Stack Front End Developer

We are looking for an experienced Full Stack Front-End Developer to lead the development and maintenance of our cutting-edge applications built on the MERN (MongoDB, Express.js, React, Node.js) stack.Job Description: Responsibilities: Front-End Development Excellence: </p ...

Software Engineer Full Stack Java

Who We Are At Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ...

Full Stack Front End Developer

We are looking for an experienced Full Stack Front-End Developer to lead the development and maintenance of our cutting-edge applications built on the MERN (MongoDB, Express.js, React, Node.js) stack.Job Description: Responsibilities: Front-End Development Excellence: </p ...

Raven: Full stack Engineer Role

Raven is a YC-backed startup (S22) building AI assistants for manufacturing plants. We're taking decades of manufacturing expertise and combining it with AI to solve real operational problems. Backed by top VCs, we're a small, focused team working to make industrial operations safer, smarter, and more efficie ...

Senior Full Stack (node.js) Engine...

Candidate should be able to: Design and develop microservices using node.js. Participate in agile development processes in SDLC, including sprint planning, iterative development, estimations, and design sessions Communicate effectively across desks, teams, and departments Develop clean, mo ...

🚀 Boost Your Hiring Chances with Our AI-Powered Tool-Kit

Stand out from thousands of applicants. Use our proven career tools to optimize your applications and land your dream job faster.

To-Do Planner

Organize your job search and personal tasks. All data is confidential.

Open Planner

Wellbeing Center

Access your confidential wellness report and resources to manage job search stress.

Check Wellbeing

Skill Coach

Plan your skill development with O*NET support to stay competitive in your field.

Start Coaching

Outfit Helper

Get AI-powered suggestions on what to wear for your next interview.

Find Outfit

Income Tax Calculator

Plan your finances with our calculator, updated for 2025 tax regulations.

Calculate Tax

Salary Benchmark

Get accurate, AI-supported salary trends to know your worth and negotiate better.

Check Salaries

Interview Practice

Practice for any interview with AI-enabled Q&A sessions. All data is private.

Start Practicing

Interview Predictor

Use our AI-supported tool to predict potential interview questions based on your resume.

Predict Questions

Interview Practice Timer

Use our mock interview trainer to perfect your answers under timed conditions.

Start Timer

Behavioral Mastery

Ace tricky behavioral interviews with our AI-powered practice module.

Master Answers

Question Journal

Confidentially record interview questions you were asked for future reference.

Open Journal

Interview Ace

A comprehensive tool to help you master every aspect of your interviews.

Become an Ace

Q&A Logs

Confidentially track your answers to common questions and refine them over time.

View Logs

Application Planner

Schedule and organize your job applications in one confidential planner.

Open Planner

Cover Letter Tool

Create perfect, tailored cover letters for each application with AI support.

Generate Letter

Resume Score

Get instant feedback on your resume with our NLP-supported analysis tool.

Check My Score

ATS Score

Check your resume's compatibility with Applicant Tracking Systems (ATS).

Check ATS Score

Application Analyzer

Use AI to analyze job descriptions and optimize your application materials.

Analyze Application

Career Visualizer

Confidentially plan and visualize your long-term career path and goals.

Visualize My Career

Offer Genius

Get intelligent insights and strategies to confidently negotiate job offers.

Negotiate Offers

JobFlow

Track your entire job search progress from application to offer with this intelligent tool.

Track My Flow

JobSense

Our intelligent matching engine that provides smart job recommendations.

Get Smart Matches

Networking Toolkit

Tools to build and manage your professional connections. All data is confidential.

Build Network

Professional CV

A classic, O*NET supported template for corporate and professional roles.

Use This Template

Executive CV

A premium, O*NET supported template designed for senior and C-level positions.

Use This Template

Modern CV

A fresh, stylish, O*NET supported template perfect for tech and modern industries.

Use This Template

Creative CV

A visually distinct, O*NET supported template for design and artistic roles.

Use This Template

Minimalist CV

A clean, simple, O*NET supported template that focuses purely on content.

Use This Template

Europass CV

The standard European Union recommended format for wide compatibility.

Use This Template

Student CV

An institution-recommended template perfect for internships and first jobs.

Use This Template

Graduate CV

An institution-recommended template for recent graduates entering the workforce.

Use This Template

Academic CV

The researcher-recommended format for roles in academia and research.

Use This Template

Developer/IT CV

A tech-savvy recommended template to highlight your technical skills.

Use This Template

Skilled Worker CV

A trades-recommended template to showcase hands-on skills and experience.

Use This Template

Monochrome CV

A sleek, black-and-white, O*NET supported template for a professional look.

Use This Template

Art CV

An artist-recommended template that allows your creativity to shine.

Use This Template

Harvard CV

A researcher-recommended template based on the classic Harvard format.

Use This Template

Volunteer Research

Help us improve our platform by joining our community research program.

Join Research

Review Us

Share your experience with our tools to help other job seekers.

Share Experience

Register

Create your free account to save jobs, build your profile, and track applications.

Create Account

Login

Access your dashboard, manage applications, and continue your job search.

Access Your Account

Profile Builder

Create a comprehensive professional profile that attracts recruiters and showcases your skills.

Build Your Profile

View Profile

See your public profile exactly as employers will see it. Make sure it's perfect.

Preview Profile

Bookmarked Jobs

Keep track of all your saved job opportunities in one organized place.

View Saved Jobs

Your Reviews

View and manage all the company reviews you've submitted.

See Your Reviews

Following

Manage the list of companies you follow to stay updated on their new openings.

Manage Following

Find Companies

Discover and research top employers in your country and industry.

Discover Employers

Standalone CV Builder

Use our O*NET supported CV builder to create a professional resume from scratch.

Build Your CV

PDF to DOC (Beta)

Convert your PDF resumes or documents into editable Word (DOC) format.

Convert PDF

DOC to PDF (Beta)

Create universally compatible PDF documents from your Word (DOC) files.

Create PDF

General FAQ

Find answers to common questions about our job site and platform.

Read FAQ

Job Seekers FAQ

Get help and find answers to questions specifically for job seekers.

Get Help

Job Matching

Learn about the technology and algorithms behind how we match you to jobs.

Learn How

Personalized Matching

Discover how we use your profile and activity to provide customized job suggestions.

Learn More

Quick Apply

Understand our fast application process and how to make the most of it.

Learn More

Alert Frequency

Learn how to manage your job alert settings so you get the updates you want.

Manage Settings

Job Alerts Guide

A complete guide to understanding how job alerts work and how to use them effectively.

Read Guide

Resume Matching

Learn how our system matches your resume to job requirements.

Learn More

Ethical Branding

Read our guide to building a professional and ethical personal brand.

Read Guide

Candidate Visibility

Learn how to increase your visibility to recruiters on our platform.

Increase Visibility

Verified Badge

Find out how you can get a verified badge to build trust with employers.

Get Verified

AI ATS Technology

Learn about the advanced AI and ATS technology that powers our platform.

Learn More

ATS Ranking

Understand how Applicant Tracking Systems rank you as an applicant.

Learn More

Semantic Matching

Learn how our AI-powered semantic matching goes beyond keywords.

Learn More

    Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights