📑 Graphic Designer & Video Editor (AI-Savvy) We’re looking for a creative all-rounder with strong design aesthetics, a knack for video content, and a willingness to explore AI tools. If you can design, shoot, edit, and experiment—you’ll thrive here. Responsibilities ...
📑 Graphic Designer & Video Editor (AI-Savvy)We’re looking for a creative all-rounder with strong design aesthetics, a knack for video content, and a willingness to explore AI tools. If you can design, shoot, edit, and experiment—you’ll thrive here.ResponsibilitiesDesi ...
📑 Company DescriptionNurall is dedicated to creating harmonious living spaces that prioritize well-being and mindfulness. Guided by the philosophy that well-being is the new luxury, we curate transformative experiences and design tranquil homes. Our flagship project, Raha Villas, is a boutique collection of Ba ...
📑 Graphic Designer & Video Editor (AI-Savvy) We’re looking for a creative all-rounder with strong design aesthetics, a knack for video content, and a willingness to explore AI tools. If you can design, shoot, edit, and experiment—you’ll thrive here. Responsibilities ...
📑 Graphic Designer & Video Editor (AI-Savvy) We’re looking for a creative all-rounder with strong design aesthetics, a knack for video content, and a willingness to explore AI tools. If you can design, shoot, edit, and experiment—you’ll thrive here. Responsibilities ...
📑 Graphic Designer & Video Editor (AI-Savvy) We’re looking for a creative all-rounder with strong design aesthetics, a knack for video content, and a willingness to explore AI tools. If you can design, shoot, edit, and experiment—you’ll thrive here. Responsibilities ...
📑 Graphic Designer & Video Editor (AI-Savvy)We’re looking for a creative all-rounder with strong design aesthetics, a knack for video content, and a willingness to explore AI tools. If you can design, shoot, edit, and experiment—you’ll thrive here.ResponsibilitiesDesi ...
📑 Graphic Designer & Video Editor (AI-Savvy)We’re looking for a creative all-rounder with strong design aesthetics, a knack for video content, and a willingness to explore AI tools. If you can design, shoot, edit, and experiment—you’ll thrive here.ResponsibilitiesDesi ...
📑 Graphic Designer & Video Editor (AI-Savvy) We’re looking for a creative all-rounder with strong design aesthetics, a knack for video content, and a willingness to explore AI tools. If you can design, shoot, edit, and experiment—you’ll thrive here. Responsibilities ...
📑 Graphic Designer & Video Editor (AI-Savvy) We’re looking for a creative all-rounder with strong design aesthetics, a knack for video content, and a willingness to explore AI tools. If you can design, shoot, edit, and experiment—you’ll thrive here. Responsibilities ...
📑 Graphic Designer & Video Editor (AI-Savvy)We’re looking for a creative all-rounder with strong design aesthetics, a knack for video content, and a willingness to explore AI tools. If you can design, shoot, edit, and experiment—you’ll thrive here.ResponsibilitiesDesi ...
📑 Graphic Designer & Video Editor (AI-Savvy)We’re looking for a creative all-rounder with strong design aesthetics, a knack for video content, and a willingness to explore AI tools. If you can design, shoot, edit, and experiment—you’ll thrive here.ResponsibilitiesDesi ...
📑 Graphic Designer & Video Editor (AI-Savvy)We’re looking for a creative all-rounder with strong design aesthetics, a knack for video content, and a willingness to explore AI tools. If you can design, shoot, edit, and experiment—you’ll thrive here.ResponsibilitiesDesi ...
📑 Graphic Designer & Video Editor (AI-Savvy) We’re looking for a creative all-rounder with strong design aesthetics, a knack for video content, and a willingness to explore AI tools. If you can design, shoot, edit, and experiment—you’ll thrive here. Responsibilities ...
📑 Description & Summary: We areseekinga highly skilled and motivated Full Stack AI Engineer to join our team as a Senior Associate. In this role, you will work oncutting-edgetechnologies, focusing on Generative AI (GenAI) and Agentic AI solutions. You will play a critical part in building, ...
📑 Urgent Opening: MERN Stack Developer (35 Years) Position: MERN Stack Developer Location: Chennai (On-site Only) Experience: 35 Years Employment Type: Full-time About the ...
📑 Description & Summary: We areseekinga highly skilled and motivated Full Stack AI Engineer to join our team as a Senior Associate. In this role, you will work oncutting-edgetechnologies, focusing on Generative AI (GenAI) and Agentic AI solutions. You will play a critical part in buildin ...
📑 Urgent Opening: MERN Stack Developer (35 Years) Position: MERN Stack Developer Location: Chennai (On-site Only) Experience: 35 Years Employment Type: Full-time About t ...
📑 Job Details Requirement Type Permanent Job Title Opening for Technical Consultant. Job Level Executive - Non-Managerial Job Description Java Full stack Trainer. No. of Openings 6 Job Domain IT Experience - Minimum - Maximum Full stack Trainer Expected Date Of Joining 2026-05-14 Joinin ...
📑 Job Details Requirement Type Permanent Job Title Opening for Technical Consultant. Job Level Executive - Non-Managerial Job Description Java Full stack Trainer. No. of Openings 6 Job Domain IT Experience - Minimum - Maximum Full stack Trainer Expected Date Of Joining Joining Tim ...
📑 About Mitigata Mitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to strengthen their security ...
📑 About Mitigata Mitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with busines ...
📑 About Mitigata Mitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to strengthen their security posture, e ...
📑 About Mitigata Mitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to strengthen their security posture, e ...
📑 About Mitigata Mitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to str ...
📑 About Mitigata Mitigata is India‘s first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to strengthen their security ...
📑 About Mitigata Mitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with busines ...
📑 About Mitigata Mitigata is India‘s first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work wit ...
📑 About Mitigata Mitigata is India's first Security Compliance Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to strengthen their security posture, ensure regulatory comp ...
📑 About Mitigata Mitigata is India's first Security Compliance Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to strengthen their security posture, ensure regulatory comp ...
📑 About MitigataMitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to strengthen their security posture, ensure regulatory ...
📑 About MitigataMitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to strengthen their security posture, ensure regulatory ...
📑 About Mitigata Mitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to strengthen their security ...
📑 need visa filling officerExperience2 - 8 YearsNo. of Openings2Education12th PassRoleVisa Filing OfficerIndustry TypeHotel / Restaurant / HospitalityGenderFemaleJob Coun ...
📑 Job Title: GTM Engineer (Clay Specialist) Location: Remote Role Type: Full-Time Working Hours: 9AM - 6PM Sydney Time (AEST), Monday to FridayWho Are We?At Reef, we connect elite commercial talent with high-g ...
📑 Job Title: Senior GenAI Full Stack Engineer Location: Hybrid- Bengaluru Employment Type: Full-Time With VDart Digital We are seeking a Senior GenAI Full Stack Engineer to design, build, and deploy advanced Agentic AI systems for enterprise Global Business Services (GBS) use cases, including metadata generation, ...
📑 IELTS Faculty require [full time] Amritsar (Asz272, Send resume at 7527930493 by , � Qualification - Graduation, Fresher can also apply, � English Skill and Communication Skill must required, only female staff required � Salary 20000 to 30000, Send resume by whatsapp at 75279_30493 ...
📑 IELTS Faculty require [full time] Moga (Asz273, Send resume at 7527930493 by , � Qualification - Graduation, Fresher can also apply, � English Skill and Communication Skill must required, only female staff required � Salary 20000 to 30000, Send resume by whatsapp at 75279_30493 ...
📑 IELTS Faculty require [full time] Jalandhar (Asz274, Send resume at 7527930493 by , � Qualification - Graduation, Fresher can also apply, � English Skill and Communication Skill must required, only female staff required � Salary 20000 to 30000, Send resume by whatsapp at 75279_30493 ...
📑 IELTS Faculty require [full time] Ambala (Asz275, Send resume at 7527930493 by , � Qualification - Graduation, Fresher can also apply, � English Skill and Communication Skill must required, only female staff required � Salary 20000 to 30000, Send resume by whatsapp at 75279_30493 ...
📑 IELTS Faculty require [full time] Ludhiana (Asz276, Send resume at 7527930493 by , � Qualification - Graduation, Fresher can also apply, � English Skill and Communication Skill must required, only female staff required � Salary 20000 to 30000, Send resume by whatsapp at 75279_30493 ...
📑 IELTS Faculty require [full time] Karnal (Asz277, Send resume at 7527930493 by , � Qualification - Graduation, Fresher can also apply, � English Skill and Communication Skill must required, only female staff required � Salary 20000 to 30000, Send resume by whatsapp at 75279_30493 ...
📑 IELTS Faculty require [full time] Hoshiarpur (Asz278, Send resume at 7527930493 by , � Qualification - Graduation, Fresher can also apply, � English Skill and Communication Skill must required, only female staff required � Salary 20000 to 30000, Send resume by whatsapp at 75279_30493 ...
📑 IELTS Faculty require [full time] Patiala (Asz279, Send resume at 7527930493 by , � Qualification - Graduation, Fresher can also apply, � English Skill and Communication Skill must required, only female staff required � Salary 20000 to 30000, Send resume by whatsapp at 75279_30493 ...
📑 IELTS Faculty require [full time] Batala (Asz280, Send resume at 7527930493 by , � Qualification - Graduation, Fresher can also apply, � English Skill and Communication Skill must required, only female staff required � Salary 20000 to 30000, Send resume by whatsapp at 75279_30493 ...
📑 IELTS Faculty require [full time] Gurdaspur (Asz281, Send resume at 7527930493 by , � Qualification - Graduation, Fresher can also apply, � English Skill and Communication Skill must required, only female staff required � Salary 20000 to 30000, Send resume by whatsapp at 75279_30493 ...
📑 English Speaking Teacher [full time] Amritsar (Asz283, Send resume at 7527930493 by , � Qualification - Graduation, Fresher can also apply, � English Skill and Communication Skill must required, only female staff required � Salary 20000 to 30000, Send resume by whatsapp at 75279_30493 ...
📑 English Speaking Teacher [full time] Moga (Asz284, Send resume at 7527930493 by , � Qualification - Graduation, Fresher can also apply, � English Skill and Communication Skill must required, only female staff required � Salary 20000 to 30000, Send resume by whatsapp at 75279_30493 ...
📑 English Speaking Teacher [full time] Jalandhar (Asz285, Send resume at 7527930493 by , � Qualification - Graduation, Fresher can also apply, � English Skill and Communication Skill must required, only female staff required � Salary 20000 to 30000, Send resume by whatsapp at 75279_30493 ...
📑 English Speaking Teacher [full time] Ambala (Asz286, Send resume at 7527930493 by , � Qualification - Graduation, Fresher can also apply, � English Skill and Communication Skill must required, only female staff required � Salary 20000 to 30000, Send resume by whatsapp at 75279_30493 ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,253,236+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Graphic Designer & Animator | WFH | Full Time | Artea.AI | Full-time |
| Graphic Designer & Animator | WFH | Full Time | Artea.AI | Full-time |
| Senior Architect (Full-Time, On-Site) | Nurall | Full-time |
| Graphic Designer & Animator | WFH | Full Time | Artea.AI | Full-time |
| Graphic Designer & Animator | WFH | Full Time | Artea.AI | Full-time |
| Graphic Designer & Animator | WFH | Full Time | Artea.AI | Full-time |
| Graphic Designer & Animator | WFH | Full Time | Artea.AI | Full-time |
| Graphic Designer & Animator | WFH | Full Time | Artea.AI | Full-time |
| Graphic Designer & Animator | WFH | Full Time | Artea.AI | Full-time |
| Graphic Designer & Animator | WFH | Full Time | Artea.AI | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!