📑 Full-Stack Engineering × ML × Research · Chennai / Remote · ₹30–60 LPA + 0.1–0.5% equity We're building the AI layer for fashion — the whole of it, worldwide. We start with jewelry: the hardest, most beautiful, most underexplored corner of the industry (India's jewe ...
📑 Full-Stack Engineering × ML × Research · Chennai / Remote · ₹30–60 LPA + 0.1–0.5% equity We're building the AI layer for fashion — the whole of it, worldwide. We start with jewelry: the hardest, most beautiful, most underexplored corner of the industry (India's jewe ...
📑 Project Role : Network & Svcs Operations RepresentativeProject Role Description : Configure, integrate and manage the life cycle of telecommunication network elements and associated configuration across Fulfillment and Assurance. Manage back office system data records. Support customer activ ...
📑 Full-Stack Engineering × ML × Research · Chennai / Remote · ₹30–60 LPA + 0.1–0.5% equity We're building the AI layer for fashion — the whole of it, worldwide. We start with jewelry: the hardest, most beautiful, most underexplored corner of the industry (India's jewe ...
📑 Full-Stack Engineering × ML × Research · Chennai / Remote · ₹30–60 LPA + 0.1–0.5% equity We‘re building the AI layer for fashion — the whole of it, worldwide. We start with jewelry: the hardest, most beautiful, most underexplored corner of the industry (India‘ ...
📑 The opportunity We’re looking for Senior with expertise in full-stack application development using .NET, C# for Agentic AI applications to join the TTT team in the Tax Service Line. This is a fantastic opportunity to be part of a pioneering firm while playing ...
📑 About Algotale At Algotale, we believe in the transformative potential of data to reshape industries, drive innovation, and create unparalleled value. Established in 2020 by a team of passionate and visionary professionals, Algotale set out to red ...
📑 Come help Amazon create and deploy advanced technologies to deliver packages to the customer's doorstep! Our team is seeking a Sr. Software Development Engineer to help build the core backend services that power our driver delivery mobile app. The ideal candidate is a full-stack engineer whose primary ...
📑 Required Qualifications:Experience & Technical Leadership:8+ years of progressive experience in Frontend/Full-Stack Applications Development or Systems Analysis, with a substantial and demonstrated focus on modern UI technologies, especially experience in successfully leading, ar ...
📑 Required Qualifications:Experience & Technical Leadership:8+ years of progressive experience in Frontend/Full-Stack Applications Development or Systems Analysis, with a substantial and demonstrated focus on modern UI technologies, especially experience in successfully leading, ar ...
📑 The RoleWe are looking for an experienced and proficient full-stack software engineer with over 10 years of experience, who is passionate about solving business problems in the banking and financial domain through innovation and engineering practices. This role will be responsible for writing co ...
📑 This role is for one of the Weekday's clientsSalary range: Rs 3500000 - Rs 5000000 (ie INR 35 - 50 LPA)Min Experience: 10 yearsLocation: MumbaiJobType: full-timeThis senior, high-impact position is tailored for a pragmatic, sea ...
📑 We are seeking a motivated and detail-oriented CA Industrial trainee to join our team. This role will provide hands-on experience in accounting, financial operations, and compliance, enabling you to apply your theoretical knowledge in a practical setting.Key Responsibilities: - A ...
📑 Required Qualifications:Experience & Technical Leadership:8+ years of progressive experience in Frontend/Full-Stack Applications Development or Systems Analysis, with a substantial and demonstrated focus on modern UI technologies, especially experience in successfully leading, ar ...
📑 Come help Amazon create and deploy advanced technologies to deliver packages to the customer's doorstep! Our team is seeking a Sr. Software Development Engineer to help build the core backend services that power our driver delivery mobile app. The ideal candidate is a full-stack engineer whose primary ...
📑 This role is for one of the Weekday's clients Salary range: Rs - Rs (ie INR 35 - 50 LPA) Min Experience: 10 years Location: Mumbai JobType: full-time This senior, high-impact position is tailored for a pragmatic, seasoned Tec ...
📑 Job Description Job Type: Full time Work Experience: 3-5 years Location: Ahmedabad We are seeking a skilled Senior Full Stack Developer with strong hands-on experience in Angular (frontend) and Java/Spring Boot (backend). ...
📑 Required Qualifications: Experience & Technical Leadership: 8+ years of progressive experience in Frontend/Full-Stack Applications Development or Systems Analysis, with a substantial and demonstrated focus on modern UI technologies, especially experience in successfully leading ...
📑 Required Qualifications: Experience & Technical Leadership: 8+ years of progressive experience in Frontend/Full-Stack Applications Development or Systems Analysis, with a substantial and demonstrated focus on modern UI technologies, especially experience in successfully leading ...
📑 Required Qualifications: Experience & Technical Leadership: 8+ years of progressive experience in Frontend/Full-Stack Applications Development or Systems Analysis, with a substantial and demonstrated focus on modern UI technologies, especially experience in successfully leading ...
📑 Our Mission: 6sense is on a mission to revolutionize how B2B organizations create revenue by predicting customers most likely to buy and recommending the best course of action to engage anonymous buying teams. 6sense Revenue AI is the only sales and marketing platform to unlock the ability to c ...
📑 About Algotale At Algotale, we believe in the transformative potential of data to reshape industries, drive innovation, and create unparalleled value. Established in 2020 by a team of passionate and visionary professionals, Algotale set out to re ...
📑 Job Description What we want: Vertoz is looking for a seasoned Lead Java Developer to join our engineering team in Mumbai. In this role, you will balance high-level technical strategy with hands-on execution. You will be responsible for architecting scalable systems ...
📑 The Role We are looking for an experienced and proficient full-stack software engineer with over 10 years of experience, who is passionate about solving business problems in the banking and financial domain through innovation and engineering practices. This role will be responsible for writing ...
📑 Job Description What we want: Vertoz is looking for a seasoned Lead Java Developer to join our engineering team in Mumbai. In this role, you will balance high-level technical strategy with hands-on execution. You will be responsible for architecting scalable systems ...
📑 We are seeking a motivated and detail-oriented CA Industrial trainee to join our team. This role will provide hands-on experience in accounting, financial operations, and compliance, enabling you to apply your theoretical knowledge in a practical setting. Key Responsibilities: - A ...
📑 WTF GYMS — We're Looking for a Show Runner India's Fastest-Growing Full-Stack Gym Franchise | Shark Tank India Season 3 | 60 Gyms | 50,000 Members ABOUT WTF GYMS WTF Gyms (Witness The Fitness) is redefining how India works out. Featured on Shark Tank India Season 3, we are the fastest-growing full-stack gym fran ...
📑 **Role Description:** Hands-on Full stack Java / Python Senior developer with extensive experience developing Microservices based API leveraging containerized deployment stack who will take the overall responsibility for end to end software development, continuous integration and continuous deployment, ...
📑 Description: Extensive experience in Big Data space (Hadoop Stack like M/R, HDFS, Pig, Hive, HBase, Flume, Sqoop, NoSQL stores like Cassandra, HBase etc.) across Fractal and contributes to open-source Big Data technologies. Write and tune complex Java, MapReduce, and Hive jobs. ...
📑 DescriptionJoin us in building the future of personal devices at Amazon! Are you ready to shape the future of how people experience technology in their everyday lives? Join us in building the next generation of personal devices — where hardware, software, and AI converge to create experiences that f ...
📑 We are seeking a skilled Full Stack Developer with expertise in Django and React to join our team.The ideal candidate will excel at designing, developing, and maintaining web applications usingDjango for building scalable backend systems, and React for building intuitive frontendapplicati ...
📑 Software Engineer (AI-Forward) As a Software Engineer with Texas Sports Academy, you play a key role in building the software that runs our school — student records, academic mastery tracking, training data, parent portals, admissions, and the AI-powered tools our guides and coaches use every da ...
📑 At TechBiz Global, we are providing recruitment service to our TOP clients from our portfolio. We are currently seeking a Full-stack developer to join one of our clients ' team. If you're looking for an exciting opportunity to grow in a innovative environment, this could ...
📑 About VivaOps : VivaOps is a leading DevSecOps platform company specializing in GitLab - The comprehensive DevOps platform, to transform and secure software development processes. We help organizations to streamline their DevSecOps journey by offering a complete range of GitLab services, ...
📑 Job DescriptionSenior Software Engineer (Java Full stack)PuneAbout the JobWe are seeking a highly skilled Senior Full Stack Developer with strong expertise in Java and Angular to join our dynamic team.The ideal candidate ...
📑 Senior Java Full Stack engineerLet’s be unstoppable together!At Circana, we are fueled by our passion for continuous learning and growth, we seek and share feedback freely, and we celebrate victories both big and small in an environment that is flexible and accommodating to ...
📑 Who we are VOIS (Vodafone Intelligent Solutions) is a strategic arm of Vodafone Group Plc, creating value for customers by delivering intelligent solutions through Talent, Technology & Transformation.As the largest shared services organisation in the global telco industry with ...
📑 Project Role : Technology Support EngineerProject Role Description : Resolve incidents and problems across multiple business system components and ensure operational stability. Create and implement Requests for Change (RFC) and update knowledge base articles to support effective troubleshoot ...
📑 NeuroDrift is a US-based AI voice and enterprise software company. We build real-time voice AI agents and conversational platforms (CallDash) that run live for enterprise customers across sales, support, and customer engagement — production call traffic and chat conversations every day. We're looking for a relia ...
📑 DescriptionAWS seeks a Principal AI Sales Specialist professional to drive adoption of AWS's full stack AI services across GSI & ITES sector in India and SAARC region. This individual contributor role requires deep AI/ML expertise, executive presence, and proven sales success. You'll engage C-level executive ...
📑 DescriptionAWS seeks a Principal AI Sales Specialist professional to drive adoption of AWS's full stack AI services across GSI & ITES sector in India and SAARC region. This individual contributor role requires deep AI/ML expertise, executive presence, and proven sales success. You'll engage C-level executive ...
📑 DescriptionAWS seeks a Principal AI Sales Specialist professional to drive adoption of AWS's full stack AI services across GSI & ITES sector in India and SAARC region. This individual contributor role requires deep AI/ML expertise, executive presence, and proven sales success. You'll engage C-level executive ...
📑 DescriptionAre you passionate about creating new opportunities for the brands on top of Amazon’s advertising ecosystem? Are you passionate about working on trending Amazon technologies and tools to help build real-time, performant and scalable solutions for advertisers? We build and enhance the services that ...
📑 **Introduction**A career in IBM Consulting is built on long-term client relationships and close collaboration worldwide. You’ll work with leading companies across industries, helping them shape their hybrid cloud and AI journeys. With support from our strategic partners, robust IBM technology, and Red Hat, y ...
📑 **Introduction**A career in IBM Consulting is built on long-term client relationships and close collaboration worldwide. You’ll work with leading companies across industries, helping them shape their hybrid cloud and AI journeys. With support from our strategic partners, robust IBM technology, and Red Hat, y ...
📑 **Introduction**A career in IBM Consulting is built on long-term client relationships and close collaboration worldwide. You’ll work with leading companies across industries, helping them shape their hybrid cloud and AI journeys. With support from our strategic partners, robust IBM technology, and Red Hat, y ...
📑 **Introduction**A career in IBM Consulting is built on long-term client relationships and close collaboration worldwide. You’ll work with leading companies across industries, helping them shape their hybrid cloud and AI journeys. With support from our strategic partners, robust IBM technology, and Red Hat, y ...
📑 **Introduction**A career in IBM Consulting is built on long-term client relationships and close collaboration worldwide. You’ll work with leading companies across industries, helping them shape their hybrid cloud and AI journeys. With support from our strategic partners, robust IBM technology, and Red Hat, y ...
📑 **Introduction**A career in IBM Consulting is built on long-term client relationships and close collaboration worldwide. You’ll work with leading companies across industries, helping them shape their hybrid cloud and AI journeys. With support from our strategic partners, robust IBM technology, and Red Hat, y ...
📑 WHO WE ARE LOOKING FOR The successful candidate is a proven backend senior software engineer having hands on experience with front end development with excellent communication and teamwork skills and the ability to multitask, innovate and challenge conventional thinking. WHAT YOU WILL WORK ON<b ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 916,731+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Founding AI Engineer | Thuli Studios | Full-time |
| Founding AI Engineer | Thuli Studios | Full-time |
| Network & Svcs Operations Representative | Accenture | Full-time |
| Founding AI Engineer | Thuli Studios | Full-time |
| Founding AI Engineer | Thuli Studios | Full-time |
| TTT - GenAI - Senior | EY | Full-time |
| Algotale - ISHIR (Java Fullstack Engineer) | Nexthire | Full Time |
| Sr. Software Development Engineer,... | ADCI - Karnataka | full-time |
| React Developer | 12542 Citicorp Services India Private Limited | Full time |
| React Developer | 12542 Citicorp Services India Private Limited | Full time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!