📑 Fresh Openings For Freshers/Graduates/ APPLY NOW!(Jaipur)No TargetsIndustry : Aviation / Airline / AerospaceKey Skills : Good Communication, Cabin Crew,Industry : Aviation / Airline / AerospaceFunction : Hotel / Restaurants / Travel / AirlinesPositions : 99Experience : 0 - 3 Yrs.Salary : INR - Location(s) of Job ...
📑 Job DescriptionEnsure compliance with the Companies Act, 2013 and other applicable lawsConduct and coordinate weekly Board Meetings, AGM, EGM, and committee meetingsPrepare agendas, circulate notes, maintain Minutes of Meetings (MoM), and track actio ...
📑 An Electrical Engineer is responsible for designing, developing, and testing electrical systems and equipment. They also oversee the installation and maintenance of electrical systems in buildings, aircraft, and other structures. Responsibilities of an Electrical Engineer may include:- Designing electrical syste ...
📑 Front office jobGreeting the Guest Check in and check out Filling up the form Phone Receiving Call at Experience 0 - 3 Years No. of Openings 3 Education Higher Secondary Role Front Desk Representative ...
📑 Job Description To handle patient & doctor queries for the report released ensuring they resolved smoothlyTo monitor the daily released reports & ensure error free results are reaching Patient.To write & review SOPs, procedures & quality practices for the new & existing ...
📑 *Job Description: Social Media Marketing Specialist*We are seeking a dynamic Social Media Marketing Specialist to manage and grow our online presence. The ideal candidate will create, curate, and schedule engaging content across platforms like Facebook, Instagram, Twitter, and LinkedIn. Responsibilities include ...
📑 Body Massage For Any Person Skill Experience 0 - 1 Years No. of Openings 10 Education Higher Secondary, Secondary School, Vocational Course, Diploma, Advanced/Higher Diploma, Professional Degree, B.A, B.C.A, B.Com, Any Bachelor Degree </li ...
📑 Location: Work from Office North BangaloreDuration: 26 months (can convert to full-time based on performance)Work Days: 6 days/week Who is this for?College students or freshers looking for real-world experiencePeople who are confident on c ...
📑 Location: Vadodara, Ahmedabad, Rajkot, Indore, PuneWork from Field: 100% Field Sales (Product: IT Software, Accounting, CRM, ERP, DMS, CMS, Ticking Tools Etc.,)**Key Responsibilities: **- B2B Sales Knowledge: Develop a strong understanding of the companys products and solutions, target markets, and competitive l ...
📑 Job Title: Digital Marketing (Fresher)Location: Mumbai, Navi Mumbai, Pune MaharashtraQualification: Minimum 12th PassExperience: Fresher / 04 Year ExperienceJob Type: Full-Time / Office-Based / internshipAbout the RoleAre you passionate about social media, online trends, and digital advertising?We are looking fo ...
📑 We have vacant of 45 Ground Handling Staff Jobs in Delhi NCR, Lucknow, Amritsar, Chandigarh, Ranchi, Jaipur, Nagpur, Indore, Agra, Varanasi, for Freshers Educational Qualification : Higher Secondary, Secondary School, , , , , , , ma, Skill Aviation, Ground Staff Activities, Airport Ground Handling, Ground Handli ...
📑 Dear Sir/Ma'amGreetings of the day !!!This is to inform you that we do have the job openings for fresher and experience Candidates for the profiles Ground Staff,Responsibilities:Creating accurate project specificationsDesigning engineering experimentsCreating technical reports for customersCompleting regulatory ...
📑 we are looking for sales executive for cctv, fiber and netwokring product.Experience0 - 1 YearsNo. of Openings1Education12th Pass, Any Bachelor DegreeRoleSales ExecutiveIndustry TypeIT-Hardware & Networking ...
📑 Hiring Sales Executives (Healthcare & Banking Processes)Location: Thane & MaladJoining: Immediate Joiners Preferred Healthcare Sales Process (Thane West)Shift Timings: 7 AM4 PM 12 PM9 PM 1 PM10 PMWeek Off: RotationalSalary: Up to 15,000 + IncentivesEligibility:HSC (12th Pass) minimumFreshers welcomeAverage Engli ...
📑 job description:monitoring the use of equipment and supplies within the office.dealing with queries or requests from the visitors and employees of the university office.coordinating the maintenance and repair of office equipment.assisting other administrative staff in wide range of office duties.collecting and d ...
📑 An Electrical Engineer is responsible for designing, developing, and testing electrical systems and equipment. They also oversee the installation and maintenance of electrical systems in buildings, aircraft, and other structures. Responsibilities of an Electrical Engineer may include:- Designing electrical syste ...
📑 job title: car washer / car cleaner / auto detailer location: er the detailing studio . company: er the detailing studio salary: 10,000 13,000 per monthcompany overview: er the detailing studio is a premium car care destination offering high-end detailing and protection services such as paint protection film (pp ...
📑 Hiring for 168 Customer Care Representative Jobs in Gaya, Bareilly, Gorakhpur, Kanpur, Lucknow, Ranchi, Patna, Delhi, Noida, Surat, for Freshers,Required Educational Qualification is : Higher Secondary, Secondary School, Vocational Course, Diploma, , , , , , with Good knowledge in Aviation, Aviation Security, Ai ...
📑 Inside Sales & Recruitment Intern (Full-Time)Location: Work from Office North BangaloreJoining: Immediate (This Monday)Duration: 26 months (can convert to full-time based on performance)Stipend: 10,000 12,000/m ...
📑 The CS Intern will support the Company Secretary in ensuring compliance with statutory and regulatory requirements, as well as executing various administrative tasks. You will have the opportunity to gain practical experience in corporate governance and legal matters within a dynamic business environment. ...
📑 Ensure compliance with the Companies Act, 2013 and other applicable lawsConduct and coordinate weekly Board Meetings, AGM, EGM, and committee meetingsPrepare agendas, circulate notes, maintain Minutes of Meetings (MoM), and track action pointsMain ...
📑 Job Description To handle patient & doctor queries for the report released ensuring they resolved smoothlyTo monitor the daily released reports & ensure error free results are reaching Patient.To write & review SOPs, procedures & quality practices for the new & existing ...
📑 Dear Sir/Ma'amGreetings of the day !!!This is to inform you that we do have the job openings for fresher and experience Candidates for the profiles Ground Staff,Responsibilities:Creating accurate project specificationsDesigning engineering experimentsCreating technical reports for customersCompleting regulatory ...
📑 We own *Amul Ice Cream* parlour shops in Gigaplex mindspace, Digha & K Raheja Airoli Mindspace, Airoli east. We are hiring candidates for my both shops. And We sale Amul ice cream and with that we sale milkshakes, falooda, etc. We need staff to make that and sale it to the customers. There will be a two duty tim ...
📑 Job Description To handle patient & doctor queries for the report released ensuring they resolved smoothlyTo monitor the daily released reports & ensure error free results are reaching Patient.To write & review SOPs, procedures & quality practices for the new & existing ...
📑 Hiring for 5 BE / B Tech Electrical and Electronic Engineers - Only for Nashik Candidates Jobs in Nashik for Freshers, Required Educational Qualification is : , with Good knowledge in Production Engineer, Electrical Engineer Trainee, Electrical Incharge, Mechanical Engineer, Electronics Engineer etc.Production / ...
📑 Dear Sir/Ma'amGreetings of the day !!!This is to inform you that we do have the job openings for fresher and experience Candidates for the profiles Ground Staff,Responsibilities:Creating accurate project specificationsDesigning engineering experimentsCreating technical reports for customersCompleting regulatory ...
📑 Diploma / BE Electrical- Female- Only for Nashik CandidatesCalibration EngineerFemaleDIP/BE Electrical/Electronics/E&TC/Mechanical.Freshers /Experienced With Excel KnowledgeSal- 12 to 15 KDwarka Experience 0 - 1 Years No. of Openings 5 Education < ...
📑 Health & Hygiene Related specialised Products need a two wheeler, field work , meeting customer at given time needing a concept selling, hospital networking, product demonstartion, creating sales, negotiation , dealers network, supplies and payment realisation.Experience0 - 3 YearsN ...
📑 We are looking for 681 Ground Hostess Posts in Delhi, Mumbai, Kolkata, Bhubaneswar, Jaipur, Gurgaon, Dehradun, Lucknow, Surat, Gwalior, with deep knowledge in Team Coordination, Multitasking Ability, Safety Awareness, Customer Service, Problem Solving, Communication Skills, Airport Ticketing, Airport Cargo, Airp ...
📑 We have vacant of 179 Airport Document Verification Executive Jobs in Gorakhpur, Kanpur, Lucknow, Patna, Ranchi, Delhi, Surat, Varanasi, Noida, Indore, for Freshers Educational Qualification : Higher Secondary, Secondary School, , , , , , BDS, BAMS, Bachelor of Hotel Management Skill Job Openings for 178 Airport ...
📑 - Key responsibilities:1. Verify and ensure the accuracy of data entered into databases or systems:As a data verifier, you will be responsible for checking and confirming the correctness of the information entered into various platforms.2. Conduct quality checks on data to identify any errors or discrepancies:Yo ...
📑 Job Openings for 20 Air Hostess Jobs for Freshers in Lucknow, Mathura, Madurai, Nashik, Patna, Jaipur, Chandigarh, Amritsar, Pune, Kolkata, having Educational qualification of : 12th Pass, 10th Pass, ., , , , , , , BDS with Good knowledge in Aviation, Air Hostess Activities, Hospitality, Cabin Crew Activities, S ...
📑 Ensure compliance with the Companies Act, 2013 and other applicable laws Conduct and coordinate weekly Board Meetings, AGM, EGM, and committee meetings Prepare agendas, circulate notes, maintain Minutes of Meetings (MoM), and track action points Maintain detailed minutes and documentation for: Board Meetings Int ...
📑 Description & Summary: We areseekinga highly skilled and motivated Full Stack AI Engineer to join our team as a Senior Associate. In this role, you will work oncutting-edgetechnologies, focusing on Generative AI (GenAI) and Agentic AI solutions. You will play a critical part in buildin ...
📑 Urgent Opening: MERN Stack Developer (35 Years) Position: MERN Stack Developer Location: Chennai (On-site Only) Experience: 35 Years Employment Type: Full-time About t ...
📑 Urgent Opening: MERN Stack Developer (35 Years) Position: MERN Stack Developer Location: Chennai (On-site Only) Experience: 35 Years Employment Type: Full-time About the ...
📑 Description & Summary: We areseekinga highly skilled and motivated Full Stack AI Engineer to join our team as a Senior Associate. In this role, you will work oncutting-edgetechnologies, focusing on Generative AI (GenAI) and Agentic AI solutions. You will play a critical part in building, ...
📑 Job Details Requirement Type Permanent Job Title Opening for Technical Consultant. Job Level Executive - Non-Managerial Job Description Java Full stack Trainer. No. of Openings 6 Job Domain IT Experience - Minimum - Maximum Full stack Trainer Expected Date Of Joining Joining Tim ...
📑 Job Details Requirement Type Permanent Job Title Opening for Technical Consultant. Job Level Executive - Non-Managerial Job Description Java Full stack Trainer. No. of Openings 6 Job Domain IT Experience - Minimum - Maximum Full stack Trainer Expected Date Of Joining 2026-05-14 Joinin ...
📑 Job Title: Senior GenAI Full Stack Engineer Location: Hybrid- Bengaluru Employment Type: Full-Time With VDart Digital We are seeking a Senior GenAI Full Stack Engineer to design, build, and deploy advanced Agentic AI systems for enterprise Global Business Services (GBS) use cases, including metadata generation, ...
📑 Job Title: Senior Gen AI Full Stack Engineer Location: Hybrid- Bengaluru Employment Type: Full-Time With VDart Digital We are seeking a Senior Gen AI Full Stack Engineer to design, build, and deploy advanced Agentic AI systems for enterprise Global Business Services (GBS) use cases, including metadat ...
📑 About Mitigata Mitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to str ...
📑 About Mitigata Mitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to strengthen their security posture, e ...
📑 About Mitigata Mitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to strengthen their security posture, e ...
📑 About Mitigata Mitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to strengthen their security ...
📑 About Mitigata Mitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with busines ...
📑 About Mitigata Mitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to strengthen their security ...
📑 About Mitigata Mitigata is India's first Security + Compliance + Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with busines ...
📑 About Mitigata Mitigata is India's first Security Compliance Insurance company, helping businesses mitigate cyber risks through a combination of risk assessments, compliance consulting, cyber insurance, and security solutions. We work with businesses to strengthen their security posture, ensure regulatory comp ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,631,592+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Freshers & Experience || Full Time... | AI Aviaction | FULL_TIME |
| Full Time Company Secretary (for client) | Krishna M Raju & Associates | Full-time |
| Freshers & Experience || Full Time... | DPSR Consultancy Solutions | FULL_TIME |
| Front Desk Representative (Full... | Kesar Dhani | FULL_TIME |
| Lab Head (MD Pathologist) - Full Time | Thyrocare Technologies Ltd. | Full Time Permanent |
| Social Media Marketing Specialist (Full Time) | P and R Perfect Resources Pvt. Ltd. | FULL_TIME |
| Spa Therapist (Full Time) (Only Females) | Hare Krishna Impex | PART_TIME |
| Sales & Recruitment Intern (Part/Full-Time) | Refining Skills Academy | Full time, Part time, Internship |
| Software Sales Executive - Full Time... | HADRS (HAD Recruitment Services) | FULL_TIME |
| Digital Marketing Executive - Full... | Next Edge Global | FULL_TIME |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!