📑 Greetings from Colan Infotech !!! Role - Java Fullstack Developer Experience - 4+ Years Job Location - Chennai / Bangalore Notice Period - Immediate to 15 Days only S ...
📑 What this Job Entails: We are seeking an experienced Full Stack Engineer with a minimum of 5 yearsof expertise in Core Java development on a Cloud environment. The idealcandidate should possess a deep understanding of full-stack developmentusing Java, REST APIs, and Containeriza ...
📑 Genpact (NYSE: G) is a global professional services and solutions firm delivering outcomes that shape the future. Our 125,000+ people across 30+ countries are driven by our innate curiosity, entrepreneurial agility, and desire to create lasting value for clients. We dream in digital, dare, and reinvent the wa ...
📑 What this Job Entails: We are seeking an experienced Full Stack Engineer with a minimum of 5 yearsof expertise in Core Java development on a Cloud environment. The idealcandidate should possess a deep understanding of full-stack developmentusing Java, REST APIs, and Containeriza ...
📑 Java Full Stack Developer Full Time Job Code: T-82117 | India 20 positions Required Experience 3 - 10 Years Skills Java Fullstack Developer Job Description 3+ years of hands-on applicatio ...
📑 full stack-ReactNode JS - CREQ Description Development and implementation of web applications using ReactJS, NodeJS (with NestJS or ExpressJS), and TypeScript/JavaScript. Design, optimize, and manage PostgreSQL databases, including schema design and data migration/transformation. Implement best practi ...
📑 Overview The Full Stack Web Developer will employ React and Node.js in an embedded and cloud environment to bridge our Q-SYS platform to the connected world. Q-SYS is a fast growing, award winning, software and hardware platform encompassing cutting-edge audio, video and contr ...
📑 Do you want to help solve the world's most pressing challenges? Feeding the world's growing population and slowing climate change are two of the world's greatest challenges. AGCO is a part of the solution! Join us to make your contribution. AGCO is looking to hire candidates for ...
📑 We are HRTech startup (questo.in) which offers best analytics to recruiters and companies to find the best talent faster. At Questo we are building some amazing products to change the way company and recruiters find and connect to the premium talents. We are doing some disruptive innovation while working on t ...
📑 Main Purpose: Puma Energy is seeking a Full Stack Developer to join its Digital & Technology team, supporting the design, development, and operation of its core digital platform across multiple African markets. The platform handles high-volume transactional operations spanning mobile applicatio ...
📑 CDM Smith is seeking a Full Stack Application Developer to join our Digital Engineering Solutions team. This individual will be part of the Development group within the Digital Engineering Solutions team, helping design and implementation of cloud-based solutions facilitating CI/CD practices, and ...
📑 java Full Stack Developer - CREQ Description Full Stack Developer Resource should be having 3 years of knowledge or experience working in Banking Domain Should have strong understanding of SDLC Must have excellent analytical Skills Good knowledge of Angular, Java, Oracle SQL Must have ...
📑 Job Description What we want: Seeking a Full-Stack Developer Fresher with basic knowledge of Node.js, React.js, MySQL/PostgreSQL, and Microservices Architecture. The ideal candidate should be enthusiastic about web development, eager to learn, and ready to contribute to ...
📑 We are seeking a highly skilled Full-Stack Developer to join our dynamic and growing team. If you're passionate about the latest web technologies and have a keen eye for detail, then we want to hear from you. Responsibilities: Design and development of robust, s ...
📑 We need trainers with developer mind set who has a passion to teach and mentor Experience to build live web applications with frontend, backend and database Preparing the right curriculum and content to deliver necessary training Evaluate student performance and resolve their queries Ability to explore and learn ...
📑 Skills Strong proficiency in JavaScript, including DOM manipulation and the JavaScript object model. Expertise in backend programming with Node.js and MongoDB. Experience with React.js and redux. Material UI and 3rd party libraries. Experience with clean cod ...
📑 Candidate should be able to: • Provide technical mentorship and ensure that code is developed to standards. Lead Code reviews. • Develop Project Scope Documentation to include deliverables, timelines, and budget. Work with the Project Manager and Business stakeholders to develop the desired solution. ...
📑 Job Title : Java Full Stack Developer Experience : 3 to 5 Years Work Mode : Remote Notice Period : Immediate Joiners Preferred Job Description: We ar ...
📑 Full Stack Developer (C#)The Treasury Technology team at Millennium is responsible for developing and supporting wide range of software product and services across Treasury ecosystems. In this role, you will work on sophisticated software systems that support our firm’s liquidity management and financing stra ...
📑 Role: Full Stack Developer Experience: 8+ years Location: Chennai Immediate to 30 days We are seeking an experienced Full Stack Developer with 8+ years of ...
📑 React Full-stack EngineerReact, C#, .NET, REST API Development, Azure Resources, SQL & NoSQLEnglish Communication, Unit Testing, Travel Ecosystem Knowledge (Plus)Senior 10+ Years ...
📑 About Us: We are a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, w ...
📑 About Us: We ae a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...
📑 • 10+ years in development Software solutions • Expert working knowledge of C# and .Net • Expert database skills within any RDBMS systems, primarily SQL Server • Experience in web development, mostly with SPA frameworks angular and angular JS, JavaScript, NBC, soap/rest web services • Financi ...
📑 Responsible for leading and mentoring development teams, collaborating on requirements, architecting and implementing scalable microservices, ensuring code quality and security, troubleshooting and testing solutions, managing priorities, overseeing demo content, facilitating cross-team communication, coordina ...
📑 Possesses a solid understanding of object-oriented programming concepts, ideally with proven knowledge of Visual Studio, the .NET Framework, C#, VB, MVC, SQL Server, Javascript, Jquery, and IIS. • A plus to have experience with client-side frameworks such as ReactJS and Angular. • An understanding of ...
📑 About this opportunity As a Sr. Full Stack Developer, you will work with a cross-functional agile team. Support existed and create new functionality from scratch, participate in architecture discussions, develop web applications following the up-to-date web standards, APIs and integration ...
📑 Strong experience in .NET development , including Azure Functions and Console Applications . Proficiency in Angular (latest versions) for developing modern, responsive web applications. Experience designing and developing RESTful Services/APIs . < ...
📑 Job Summary Synechron is seeking an experienced Java Full Stack Developer to craft scalable, secure, and high-performance enterprise applications. This role involves designing and developing robust back-end services with Java frameworks like Spring and Hibernate, alongside creating engaging front- ...
📑 We are looking for an experienced Technical Lead with 10+ years of full-stack development expertise in Java (Spring Boot) and Node.js to drive the design and delivery of scalable, high-performance applications in the banking domain. The ideal candid ...
📑 About the Role We are looking for enthusiastic and curious Full Stack Developer Interns who are excited to build real-world web applications that create meaningful impact in the education sector. As an intern, you will work closely with experienced ...
📑 About Us: We are a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...
📑 About Us: We are a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...
📑 Job Title Senior Full Stack Developer Location (s) Cochin Years of Experience 8-10 years Job Description 1. Lead and manage technical projects from inception to completion. 2. Full stack java developer with hands-on experience developing web application ...
📑 • 4-6 years of proven IT Experience • Full-Stack Development Expertise • Minimum, one year Javascript, proven Experience • Excellent in Java Springboot JavaScript and OOP JavaScript TypeScript ES6 • Proficient in web development • Java Springboot HTML CSS JavaScript Typescript • Sol ...
📑 Job Title: .Net Full stack Lead – (.NET Core, ReactJS, Azure) Experience Required: 7–12 YearsLocation: Hyderabad Role Overview We are seeking a highly skilled and experienced Technical Lead </str ...
📑 Let’s be #BrilliantTogether ISS STOXX is growing! ISS STOXX is looking for a Java Full Stack Developerto join ourteam in Mumbai, India. Overview: At ISS-Stoxx, we believe in purpose, mastery, and autonomy . Our mission is to empower shareholders around the world to mak ...
📑 Job Description 1. Conduct and participate in code reviews, testing, and debugging to uphold code quality and reliability.2. Demonstrated experience of at least 3 years as a Full Stack Developer, with a portfolio showcasing web application development and API i ...
📑 1. Conduct and participate in code reviews, testing, and debugging to uphold code quality and reliability.2. Demonstrated experience of at least 3 years as a Full Stack Developer, with a portfolio showcasing web application development and API integration.3. Impleme ...
📑 Job Description The Senior Full Stack Engineer is a highly skilled individual contributor who builds high-quality software while contributing to technical direction within the team. This is a hands-on role focused on delivering scalable, maintainable solutions while supporting a cultur ...
📑 Sr Full Stack Engineer Role Summary We are looking for a hands-on Full Stack Engineer to design, build, test, and maintain modern web applications using a full-stack engineering approach. The role requires strong software development fundamentals, practical experience delivering production ...
📑 At Allucent, we are dedicated to helping small-medium biopharmaceutical companies efficiently navigate the complex world of clinical trials to bring life-changing therapies to patients in need across the globe. Allucent (India) Pvt. Ltd. is seeking for Full Stack Developer to join the Country Intellige ...
📑 Position Description: Company Profile:At CGI, we’re a team of builders. We call our employees members because all who join CGI are building their own company - one that has grown to 72, professionals located in 40 countries. Founded in , CGI is a leading IT and business proce ...
📑 • 5+ Years relevant software development experience, with a Full Stack profile (Experience in front-end, backend, Integration, cloud automation, and orchestration) • Proficient in Functional & Object-Oriented Programming, Design Patterns with expertise in various cloud-native technologies (C++, Python, C#, ...
📑 Job Title: Senior Full Stack Developer Job Type: Permanent Experience: Minimum 6 years of relevant experience Location: Hyderabad Job Brief We are lookin ...
📑 Qualifications and Skills: 5+ years of hands-on experience in software development. Proficiency in C#, MVC, ASP.NET Core, and Entity Framework Core. Strong expertise in SQL Server and LINQ. Solid experience with Angular (version 10 ...
📑 We are looking for a highly skilled Full Stack Software Engineer with strong expertise in Node.js and React.js to join our team. The ideal candidate will be responsible for building scalable business platforms, contributing to risk and compliance systems, and ensuring high- ...
📑 Who We Are Applied Materials is a global leader in materials engineering solutions used to produce virtually every new chip and advanced display in the world. We design, build and service cutting-edge equipment that helps our customers manufacture display and semiconductor chips – the brains of ...
📑 Senior Full Stack DeveloperMillennium is seeking a highly skilled Senior Full Stack Developer to build and support complex inbound and outbound integrations across corporate accounting, partnership accounting, financial systems. The ideal candidate will have experience working on mission-critical appli ...
📑 Job Summary Synechron is seeking an experienced Java Full Stack Developer to craft scalable, secure, and high-performance enterprise applications. This role involves designing and developing robust back-end services with Java frameworks like Spring and Hibernate, alongside creating engaging front- ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,494,382+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Java Full Stack Developer | Colan Infotech Private Limited | Full-time |
| Full Stack Engineer III | Astreya | Full-time |
| Consultant – Full Stack Developer | Genpact | Full-time |
| Full Stack Engineer III | Astreya Consultancy India Private Ltd | Full-time |
| Java Full Stack Developer | Tavant | Full-time |
| full stack-ReactNode JS | Virtusa | Full-time |
| Full Stack Web Developer | QSC | Full-time |
| Developer, FUSE Full-Stack | AGCO | Full-time |
| Full Stack Web Developer | questo | Full-time |
| Sr. Full Stack Developer | Puma Energy | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!