1,662,486+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

Lead Product Marketing Strategist

📑 The MissionWe are looking for a high-impact, full-stack Product Marketer who can turn product strength into commercial success stories across diverse, compliance-driven markets. You won't just create content; you will act as a GTM Orchestrator. Your goal is to o ...

Senior Product Growth Marketer

📑 The MissionWe are looking for a high-impact, full-stack Product Marketer who can turn product strength into commercial success stories across diverse, compliance-driven markets. You won't just create content; you will act as a GTM Orchestrator. Your goal is to o ...

Manager MES

📑 Exide Energy Solutions Ltd is leading the way in advanced energy storage by establishing India’s first Giga plant to manufacture Lithium-Ion Cells in Bengaluru. The company specializes in designing, developing, and manufacturing high-performance Lithium-Ion Cells and Battery Pack solutions. T ...

Technical project manager

📑 About the RoleAt Dot Konnekt, we don’t just manage projects — we build momentum. Operating at the intersection of Gen-AI, full-stack engineering, and composable commerce, we’re looking for a Technical Project Manager who can translate product vision into seamless execution.You will be responsible for dri ...

SeniorProduct Marketer

📑 The Mission We are looking for a high-impact, full-stack Product Marketer who can turn product strength into commercial success stories across diverse, compliance-driven markets. You won't just create content; you will act as a GTM Orchestrator . Your goal is to own t ...

Manager MES

📑 Exide Energy Solutions Ltd is leading the way in advanced energy storage by establishing India’s first Giga plant to manufacture Lithium-Ion Cells in Bengaluru. The company specializes in designing, developing, and manufacturing high-performance Lithium-Ion Cells and Battery Pack solutions. These solu ...

SeniorProduct Marketer

📑 The MissionWe are looking for a high-impact, full-stack Product Marketer who can turn product strength into commercial success stories across diverse, compliance-driven markets. You won't just create content; you will act as a GTM Orchestrator. Your goal is to own the ...

SeniorProduct Marketer

📑 The Mission We are looking for a high-impact, full-stack Product Marketer who can turn product strength into commercial success stories across diverse, compliance-driven markets. You won't just create content; you will act as a GTM Orchestrator . Your goal is to own the value chain from ...

Staff Software Engineer Backend

📑 P-1385At Databricks, we are passionate about enabling data teams to solve the world's toughest problems — from making the next mode of transportation a reality to accelerating the development of medical breakthroughs. We do this by building and running the world's best data and AI infrastructure platfo ...

Motion Graphic Designing Intern

📑 We are looking for a Motion Graphic Designer to join our marketing team and bring our brand stories to life through stunning motion graphics, videos, and AI-powered creative experiments.Required Skills & Tools● 0 - 1 year internship experience in Notion Graphic Designing● Strong kn ...

Team Lead Treasury Tech.

📑 Team Lead - Treasury TechWe're seeking a highly skilled and experienced individual to join our team as a Team Lead in Treasury Technology. The treasury function at Millennium covers several areas: Cash and collateral management, Financing, Liquidity Management, Margin, Financing Optimization and Counterparty ...

Quantitative Strat Control Strats VP

📑 Description The Group Strategic Analytics (GSA) concentrates the Bank's quantitative and modelling expertise within a single unit. With group-wide responsibility for model development GSA takes a cross-business and cross-functional approach to solving quantitative challenges and rolls ou ...

Application Consultant

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment. This is an individual contri ...

Application Consultant

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment. This is an individual contri ...

AI/FDE Engineer

📑 Role Summary The Forward Deployed Engineer (FDE) sits at the intersection of AI engineering and client delivery. This is a hands-on, client-facing technical role responsible for architecting and building customized agentic solutions directly within client environments. The FDE does not hand off work to implement ...

Application Consultant

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment. This is an individual contri ...

Application Consultant

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment. This is an individual contri ...

AI Tech Lead

📑 Our Client A global leader in the BPO sector offering world-class CX and Service Centres at all their locations. They service industries such as eCommerce, Retail, Food Delivery, and Technology. Package Up to 25 Lakh ...

Sr. Software Engineer (TCF)

📑 Description We're Concentrix. The intelligent transformation partner. Solution-focused. Tech-powered. Intelligence-fueled. The global technology and services leader that powers the world’s best brands, today and into the future. We’re solution-focused, tech-powered, intelligence-fueled. With ...

Application Consultant

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment. This is an individual contri ...

Application Consultant

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment.This is an individual contrib ...

Application Consultant

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment. This is an individual contri ...

Gen AI Engineer

📑 We are looking for anAI Engineer with proven hands-on experiencedesigning, building, and deploying AI-powered workflow automation solutions within enterprise environments.This role is ideal for someone who understands both business processes and technology, and can work directly with stak ...

Application Consultant

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment.This is an individual contrib ...

Application Consultant

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment. This is an individual contri ...

Internal Systems & Cloud Solutions Engineer

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment.This is an individual contr ...

Application Consultant

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment.This is an individual contr ...

Fullstack Web Application Specialist

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment.This is an individual contr ...

Application Consultant

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment. This is an individual contri ...

Application Consultant

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment.This is an individual contrib ...

Business Technology & Data Privacy Consultant

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment.This is an individual contr ...

Application Consultant

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment.This is an individual contrib ...

Gen AI Engineer

📑 We are looking for anAI Engineer with proven hands-on experiencedesigning, building, and deploying AI-powered workflow automation solutions within enterprise environments.This role is ideal for someone who understands both business processes and technology, and can work directly with stak ...

Application Consultant

📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment. This is an individual contri ...

Sr. Software Engineer (TCF)

📑 Description We're Concentrix. The intelligent transformation partner. Solution-focused. Tech-powered. Intelligence-fueled. The global technology and services leader that powers the world’s best brands, today and into the future. We’re solution-focused, tech-powered, intelligence-fueled. ...

Sr. Software Engineer (TCF)

📑 Description We're Concentrix. The intelligent transformation partner. Solution-focused. Tech-powered. Intelligence-fueled. The global technology and services leader that powers the world’s best brands, today and into the future. We’re solution-focused, tech-powered, intelligence-fueled. ...

Fullstack Engineer

📑 This role is for one of the Weekday's clientsSalary range: Rs 1200000 - Rs 1800000 (ie INR 12-18 LPA)Experience: 2+ yrsLocation: GurugramJob Type: full-timeWe are seeking a highly motivated Full Stack Engineer with a strong bac ...

Senior Software Engineer (Golang, Python, SQL)

📑 Job DescriptionAs a Senior Software Developer at Digital-shelf NielsenIQ’s platform for omnichannel CPG brands analytics, you’ll work across as backend software to deliver scalable, high-performance solutions that drive real-time insights for our clients. Key Responsibilities: < ...

Sr. Software Engineer (TCF)

📑 Description We're Concentrix. The intelligent transformation partner. Solution-focused. Tech-powered. Intelligence-fueled. The global technology and services leader that powers the world’s best brands, today and into the future. We’re solution-focused, tech-powered, intelligence-fueled. ...

Technical Architect BLE

📑 Quest Global is an organization at the forefront of innovation and one of the world’s fastest growing engineering services firms with deep domain knowledge and recognized expertise in the top OEMs across seven industries. We are a twenty-five-year-old company on a journey to becoming a centenary one, driven b ...

Senior Software Engineer – Recruiting World Wide

📑 Responsibilities Technical Leadership: You’ll set strategic direction and drive successful delivery of high impact products built on Pngme’s unique data infrastructure, which currently peaks at 5k events/second and processes billions of events. You’ll evolve Pngme’s data infrastructure to m ...

Professor Of Computer Science

📑 Job Summary: JECRC College, Jaipur invites applications for the position of Professor (Computer Science) from accomplished academicians with expertise in Artificial Intelligence (AI), Data Science, Machine Learning, Cybersecurity, and emerging technologies, along with strong teaching, research, and academic admi ...

Fullstack Engineer (React+Node)

📑 Greetings from TCS! Job Title: Fullstack Engineer (React+Node) Location: Pune, Bangalore Experience Range: 6-10 yrs Job description: TCS has always been in the spotlight for being adept in the next big ...

Senior Mobile App Dev React Native

📑 We need a Senior Mobile App Lead Dev with 8 years of experience to maintain, optimize, and extend our existing enterprise mobile application. This role requires hands-on expertise with camera-based scanning workflows (QR/barcodes) and libraries, specifically VisionCamera . The ideal candidate must step into an ...

Software Development Engineer, Amazon Devices

📑 DescriptionAmazon Devices Supply chain Technologies org develops and supports systems and processes that make planning, manufacturing, launching and supporting our devices as efficient and frictionless as possible. We are growing and looking for a talented Software Development Manager to help build our Suppl ...

Software Engineer

📑 Please note this posting is to advertise potential job opportunities. This exact role may not be open today but could open in the near future. When you apply, a Cisco representative may contact you directly if a relevant position opens. Build custom, full-stack applications that connect our core Workday ...

Generative AI Software Engineer, Technology Strategy – Assistant Vice President

📑 Do you thrive on solving complex problems and building full-stack solutions that make an impact? Ready to influence big tech decisions and help shape the technology strategy of a global bank? The Chief Technology Office (CTO) is building out its Technology Strategy practice, which is responsible to dev ...

Senior Java Developer Assistant Vice President

📑 The Applications Development Senior Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute to applic ...

Senior Java Developer Assistant Vice President

📑 The Applications Development Senior Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute to applic ...

Senior Verification Engineer

📑 NVIDIA has continuously reinvented itself. Our invention of the GPU sparked the growth of the PC gaming market, redefined modern computer graphics, and revolutionized parallel computing. Today, research in artificial intelligence is booming worldwide, which calls for highly scalable and massively parallel comput ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,662,486+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
Lead Product Marketing Strategist greytHR Full-time
Senior Product Growth Marketer greytHR Full-time
Manager - MES Exide Energy Solutions Ltd Full-time
Technical project manager DotKonnekt Full-time
SeniorProduct Marketer greytHR Full-time
Manager - MES Exide Energy Solutions Ltd Full-time
SeniorProduct Marketer greytHR Full-time
SeniorProduct Marketer greytHR Full-time
Staff Software Engineer - Backend Databricks Full-time
Motion Graphic Designing Intern DocsApp Full time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!