📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment. This is an individual contri ...
📑 Description We're Concentrix. The intelligent transformation partner. Solution-focused. Tech-powered. Intelligence-fueled. The global technology and services leader that powers the world’s best brands, today and into the future. We’re solution-focused, tech-powered, intelligence-fueled. ...
📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment. This is an individual contri ...
📑 Job Description As a Senior Software Developer at Digital-shelf NielsenIQ’s platform for omnichannel CPG brands analytics, you’ll work across as backend software to deliver scalable, high-performance solutions that drive real-time insights for our clients. Key Responsibilitie ...
📑 Description We're Concentrix. The intelligent transformation partner. Solution-focused. Tech-powered. Intelligence-fueled. The global technology and services leader that powers the world’s best brands, today and into the future. We’re solution-focused, tech-powered, intelligence-fueled. ...
📑 Description We're Concentrix. The intelligent transformation partner. Solution-focused. Tech-powered. Intelligence-fueled. The global technology and services leader that powers the world’s best brands, today and into the future. We’re solution-focused, tech-powered, intelligence-fueled. ...
📑 This role is for one of the Weekday's clientsSalary range: Rs 1200000 - Rs 1800000 (ie INR 12-18 LPA)Experience: 2+ yrsLocation: GurugramJob Type: full-timeWe are seeking a highly motivated Full Stack Engineer with a strong bac ...
📑 Job DescriptionAs a Senior Software Developer at Digital-shelf NielsenIQ’s platform for omnichannel CPG brands analytics, you’ll work across as backend software to deliver scalable, high-performance solutions that drive real-time insights for our clients. Key Responsibilities: < ...
📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment. This is an individual contri ...
📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment. This is an individual contri ...
📑 Description We're Concentrix. The intelligent transformation partner. Solution-focused. Tech-powered. Intelligence-fueled. The global technology and services leader that powers the world’s best brands, today and into the future. We’re solution-focused, tech-powered, intelligence-fueled. With ...
📑 Description We're Concentrix. The intelligent transformation partner. Solution-focused. Tech-powered. Intelligence-fueled. The global technology and services leader that powers the world’s best brands, today and into the future. We’re solution-focused, tech-powered, intelligence-fueled. With ...
📑 This role is for one of the Weekday's clients Salary range: Rs - Rs (ie INR 12-18 LPA) Experience: 2+ yrs Location: Gurugram Job Type: full-time We are seeking a highly motivated Full Stack Engineer with a strong backend engineering ...
📑 Our Client A global leader in the BPO sector offering world-class CX and Service Centres at all their locations. They service industries such as eCommerce, Retail, Food Delivery, and Technology. Package Up to 25 Lakh ...
📑 Description We're Concentrix. The intelligent transformation partner. Solution-focused. Tech-powered. Intelligence-fueled. The global technology and services leader that powers the world’s best brands, today and into the future. We’re solution-focused, tech-powered, intelligence-fueled. With ...
📑 Sciente is a Singapore HQ, ISO9001, ISO27001 and Personal Data Protection Trustmark certified business technology consulting firm within BFSI. We are a trusted partner in intelligent transformations with our Data & AI expertise and technology talent emplowerment. This is an individual contri ...
📑 Role Summary The Forward Deployed Engineer (FDE) sits at the intersection of AI engineering and client delivery. This is a hands-on, client-facing technical role responsible for architecting and building customized agentic solutions directly within client environments. The FDE does not hand off work to implement ...
📑 Quest Global is an organization at the forefront of innovation and one of the world’s fastest growing engineering services firms with deep domain knowledge and recognized expertise in the top OEMs across seven industries. We are a twenty-five-year-old company on a journey to becoming a centenary one, driven b ...
📑 Responsibilities Technical Leadership: You’ll set strategic direction and drive successful delivery of high impact products built on Pngme’s unique data infrastructure, which currently peaks at 5k events/second and processes billions of events. You’ll evolve Pngme’s data infrastructure to m ...
📑 DescriptionAmazon Devices Supply chain Technologies org develops and supports systems and processes that make planning, manufacturing, launching and supporting our devices as efficient and frictionless as possible. We are growing and looking for a talented Software Development Manager to help build our Suppl ...
📑 Please note this posting is to advertise potential job opportunities. This exact role may not be open today but could open in the near future. When you apply, a Cisco representative may contact you directly if a relevant position opens. Build custom, full-stack applications that connect our core Workday ...
📑 Do you thrive on solving complex problems and building full-stack solutions that make an impact? Ready to influence big tech decisions and help shape the technology strategy of a global bank? The Chief Technology Office (CTO) is building out its Technology Strategy practice, which is responsible to dev ...
📑 The Applications Development Senior Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute to applic ...
📑 The Applications Development Senior Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute to applic ...
📑 NVIDIA has continuously reinvented itself. Our invention of the GPU sparked the growth of the PC gaming market, redefined modern computer graphics, and revolutionized parallel computing. Today, research in artificial intelligence is booming worldwide, which calls for highly scalable and massively parallel comput ...
📑 We need a Senior Mobile App Lead Dev with 8 years of experience to maintain, optimize, and extend our existing enterprise mobile application. This role requires hands-on expertise with camera-based scanning workflows (QR/barcodes) and libraries, specifically VisionCamera . The ideal candidate must step into an ...
📑 Requisition ID: 71304 About Whirlpool IndiaTransforming Vision into Reality: The Global Transforming Vision into Reality: The Global Technology & Engineering Center where India’s world-class talent architects the next generation of home innovation.< ...
📑 Job Description Position: Google Full Stack ArchitectExperience: 10+ YearsLocation: Gurgaon/HybridEmployment Type: Full-Time Job Summary<p dir= ...
📑 Requisition ID: 71304 About Whirlpool India Transforming Vision into Reality: The Global Transforming Vision into Reality: The Global Technology & Engineering Center where India’s world-class talent architects the next generation of home innovation. ...
📑 Job Summary: JECRC College, Jaipur invites applications for the position of Professor (Computer Science) from accomplished academicians with expertise in Artificial Intelligence (AI), Data Science, Machine Learning, Cybersecurity, and emerging technologies, along with strong teaching, research, and academic admi ...
📑 Greetings from TCS! Job Title: Fullstack Engineer (React+Node) Location: Pune, Bangalore Experience Range: 6-10 yrs Job description: TCS has always been in the spotlight for being adept in the next big ...
📑 HCL is having a walking drive in Hyderabad Madhapur office on 14th june 2026 please apply who are interested. Exp:5-10years Maximum CTC given is 23LPA Location-Hyderabad Mail your resume to: We are searching for a Data Scientist to jo ...
📑 HCL is having a walking drive in Hyderabad Madhapur office on 14th june 2026 please apply who are interested.Exp:5-10yearsMaximum CTC given is 23LPALocation-HyderabadMail your ...
📑 HCL is having a walking drive in Hyderabad Madhapur office on 14th june 2026 please apply who are interested.Exp:5-10yearsMaximum CTC given is 23LPALocation-HyderabadMail your ...
📑 HCL is having a walking drive in Hyderabad Madhapur office on 14th june 2026 please apply who are interested.Exp:5-10yearsMaximum CTC given is 23LPALocation-HyderabadMail your ...
📑 HCL is having a walking drive in Hyderabad Madhapur office on 14th june 2026 please apply who are interested.Exp:5-10yearsMaximum CTC given is 23LPALocation-HyderabadMail your ...
📑 HCL is having a walking drive in Hyderabad Madhapur office on 14th june 2026 please apply who are interested. Exp:5-10years Maximum CTC given is 23LPA Location-Hyderabad Mail your resume to: We are searching for a Data Scientist to jo ...
📑 HCL is having a walking drive in Hyderabad Madhapur office on 14th june 2026 please apply who are interested.Exp:5-10yearsMaximum CTC given is 23LPALocation-HyderabadMail your resume to: We are searching for a Data Scientist to join our tea ...
📑 HCL is having a walking drive in Hyderabad Madhapur office on 14th june 2026 please apply who are interested.Exp:5-10yearsMaximum CTC given is 23LPALocation-HyderabadMail your ...
📑 HCL is having a walking drive in Hyderabad Madhapur office on 14th june 2026 please apply who are interested. Exp:5-10years Maximum CTC given is 23LPA Location-Hyderabad <e ...
📑 HCL is having a walking drive in Hyderabad Madhapur office on 14th june 2026 please apply who are interested. Exp:5-10years Maximum CTC given is 23LPA Location-Hyderabad Mail your resume to: We are searching for a Data Scientist to jo ...
📑 HCL is having a walking drive in Hyderabad Madhapur office on 14th june 2026 please apply who are interested. Exp:5-10years Maximum CTC given is 23LPA Location-Hyderabad <e ...
📑 ABOUT TRICOGTricog is a healthcare technology, product-based company headquartered in Bangalore. We build predictive and virtual diagnostic solutions for cardiovascular diseases, enabling clinicians to make faster, more accurate decisions that save lives.Our software directly supports clinical decision-m ...
📑 Job Title: Mold Designer / Design Engineer / Mould Design Engineer Location: Malad West, Mumbai Employment Type: Full-time, On-site Company Overview: Jyoti World Private Limited is a well-established company with over 60 years in the plastics manufacturing ...
📑 Job Title: Mold Designer / Design Engineer / Mould Design Engineer Location: Malad West, Mumbai Employment Type: Full-time, On-site Company Overview: Jyoti World Private Limited is a well-established company with over ...
📑 Job Title: Mold Designer / Design Engineer / Mould Design EngineerLocation: Malad West, MumbaiEmployment Type: Full-time, On-siteCompany Overview: Jyoti World Private Limited is a well-established company with over 60 yea ...
📑 ABOUT TRICOGTricog is a healthcare technology, product-based company headquartered in Bangalore. We build predictive and virtual diagnostic solutions for cardiovascular diseases, enabling clinicians to make faster, more accurate decisions that save lives.Our software directly supports clinical decision-m ...
📑 Job Title: Mold Designer / Design Engineer / Mould Design EngineerLocation: Malad West, MumbaiEmployment Type: Full-time, On-siteCompany Overview: Jyoti World Private Limited is a well-established company with over 60 years in the plastics manufacturing industr ...
📑 Job Title: Mold Designer / Design Engineer / Mould Design Engineer Location: Malad West, Mumbai Employment Type: Full-time, On-site Company Overview: Jyoti World Private Limited is a well-established company with over 60 years in the plastics manufacturing ...
📑 Job Title: Mold Designer / Design Engineer / Mould Design Engineer Location: Malad West, Mumbai Employment Type: Full-time, On-site Company Overview: Jyoti World Private Limited is a well-established company with over ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,697,681+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Application Consultant | SCIENTE | Full-time |
| Sr. Software Engineer (TCF) | Concentrix | Full time |
| Application Consultant | SCIENTE | Full-time |
| Senior Software Engineer (Golang,... | NielsenIQ | Full-time |
| Sr. Software Engineer (TCF) | Concentrix | Full time |
| Sr. Software Engineer (TCF) | Concentrix | Full time |
| Fullstack Engineer | Weekday AI | Full time |
| Senior Software Engineer (Golang,... | NielsenIQ | Full-time |
| Application Consultant | SCIENTE | Full-time |
| Application Consultant | SCIENTE | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!