📑 Sitecore - CREQ Description 1. 5+ years of Sitecore experience, preferably Sitecore certified on and/or greater. Preferred to have experience on Sitecore and Headless JSS development. 2. Experience in Digital Marketing, Digital Asset Management, EXM, Analytics etc. 3.Experience with Siteco ...
📑 Role Overview This is a full-stack marketing role responsible for building brand, driving awareness, and generating high-quality leads through content, social media, and campaigns. Key Responsibilities Develop and execute content strategy across platforms (LiinkedIn, Instagram, Yo ...
📑 Site Reliability Engineer II (CVXJP) Type: Months Contract-to-Hire Location: Bengaluru (Work from Office) Shift: :–: Experience Required: – years Key Responsibilities: Drive proactive incident prevention through full-stack unde ...
📑 About the company: One of the company offering a wide range of insurance products and services , including life insurance, disability income insurance. Experience:8+yrs Location: Chennai Roles and Responsibilities: Lead Full Stack Developer with ex ...
📑 Role Overview We are looking for a skilled Java Fullstack Developer with strong experience in backend development using Java and frontend development using TypeScript and Next.js . The ideal candidate should have hands-on experience buildi ...
📑 We're Hiring: Group Marketing Manager (B2B Industrial) Noida | Full-Time | Reports to CEO/MD The Company The company is India's leading provider of safe, productive, and high-quality Industrial solutions. With a manufacturing heritage tracing back to 1930, the Group has evolved into a multi-entity conglomerate o ...
📑 Hiring: Manager/ Senior Manager – Digital Marketing | Vega Industries Pvt. Ltd.We are looking for a highly technical and performance-driven digital marketing leader to own and scale our digital growth engine.: Manager/Senior Manager – Digital Marketing: 10+ Years: Sector 136, Noida5.5 .• ...
📑 Assistant Professor - CSEImmediate joiner will be given preferenceGraduation- B. Tech/B. E. (CSE/IT/AI)Post-Graduation- M. Tech/M. E./M. S. (CSE/IT/Software Systems) any other computer science field Ph. D. in any Computer Science Fiel dArtificial Intelligence & Machine Learning, Internet of T ...
📑 Role: AI/ML EngineerLocation: Noida/ BLR/ PuneWe are hiring AI/ML Engineers for Product based company in Insurance domain to build accelerators, data products, and AI-infused tools. This is an opportunity to build cutting-edge AI solutions that transform insurance operations- from underwriting automation ...
📑 Seeking a Specialist with 5 to 7 years of experience in automation within FullStack Engineering focused on System Integration and Deployment Job Description Design develop and implement automated solutions to streamline system integration and deployment processes Collaborate with crossfunctional teams to enhance ...
📑 RTL FPGA Design EngineerExperience: 2 to 4 YearsLocation: Hyderabad, India.Job Description:- Minimum of 2 years of RTL design and development experience, preferably in a customer facing role- Minimum of 2 years of experience in FPGA Verilog design, technology, and tools- Experience in dev ...
📑 About the company: One of the company offering a wide range of insurance products and services, including life insurance, disability income insurance. Experience:8+yrs Location: Chennai Roles and Responsibilities: Lead Full Stack Developer with expertise in C#/.NET Cor ...
📑 Rivvun AI is looking for a hands-on AI Developer to design, build, and deploy the next generation of intelligent applications from the ground up. We aren't just plugging into APIs— we are building a scalable, secure, and reusable enterprise AI platform. Key Responsibili ...
📑 Hiring: Manager/ Senior Manager – Digital Marketing | Vega Industries Pvt. Ltd.We are looking for a highly technical and performance-driven digital marketing leader to own and scale our digital growth engine.: Manager/Senior Manager – Digital Marketing: 10+ Years: Sector 136, Noida<br/ ...
📑 Lead RTL Design Engineer (ASIC)Location: Chennai, Tamil NaduExperience: 6 to 9 YearsJob Description6 to 9 Years of experience in Synthesis, Constraints and interface timing Challenges. Good knowledge of Power is preferable.Strong Domain Knowledge on RTL Design, impleme ...
📑 Seeking a Specialist with 5 to 7 years of experience in automation within FullStack Engineering focused on System Integration and DeploymentJob DescriptionDesign develop and implement automated solutions to streamline system integration and deployment processes Collaborate with crossfunctional teams to e ...
📑 RTL FPGA Design EngineerExperience: 2 to 4 YearsLocation: Hyderabad, India.Job Description:- Minimum of 2 years of RTL design and development experience, preferably in a customer facing role- Minimum of 2 years of experience in FPGA Verilog design, technology, and tools- Experience in dev ...
📑 About the Role This is not a traditional Sales Engineering role. You are a builder who sits at the intersection of engineering and revenue—the person who turns a prospect’s “can it do this?” into a live, working experience they can touch. You will own the technical narrative across the deal cycle by writing code ...
📑 RTL FPGA Design EngineerExperience: 2 to 4 YearsLocation: Hyderabad, India.Job Description:Minimum of 2 years of RTL design and development experience, preferably in a customer facing roleMinimum of 2 years of experience in FPGA Verilog design, technology, and toolsExperience ...
📑 Role: AI/ML EngineerLocation: Noida/ BLR/ PuneWe are hiring AI/ML Engineers for Product based company in Insurance domain to build accelerators, data products, and AI-infused tools. This is an opportunity to build cutting-edge AI solutions that transform insurance operations- from underwriting automation ...
📑 We are looking for an experiencedTechnology Manager (Delivery Leader)to drive large-scale programs, lead high-performing teams, and partner with global stakeholders to deliver impactful technology solutions.Must Have12+ years of experience with 3+ years in delivery/tech leadersh ...
📑 Assistant Professor - CSEImmediate joiner will be given preferenceGraduation - B.Tech/B.E. (CSE/IT/AI)Post-Graduation - M.Tech/M.E./M.S. (CSE/IT/Software Systems) any other computer science fieldPh. D. in any Computer Science Fiel dArtificial Intelligence & Machine Learning, Inter ...
📑 Assistant Professor - CSEImmediate joiner will be given preferenceGraduation- B. Tech/B. E. (CSE/IT/AI)Post-Graduation- M. Tech/M. E./M. S. (CSE/IT/Software Systems) any other computer science field Ph. D. in any Computer Science Fiel dArtificial Intelligence & Machine Learning, Internet of T ...
📑 The Job in Short -The Platform Engineer is an infrastructure specialist focused on providing shared foundations across teams within a Value Stream. You design and deliver organization-wide SDLC technical improvements and reduce toil through automation. You act as the bridge between development needs and cost ...
📑 We're Hiring: Group Marketing Manager (B2B Industrial) Noida | Full-Time | Reports to CEO/MD The Company The company is India's leading provider of safe, productive, and high-quality Industrial solutions. With a manufacturing heritage tracing back to 1930, the Group has evolved into a multi-entity conglomerate o ...
📑 Role Overview This is a full-stack marketing role responsible for building brand, driving awareness, and generating high-quality leads through content, social media, and campaigns. Key Responsibilities Develop and execute content strategy across platforms (LiinkedIn, Instagram, YouTu ...
📑 Job DescriptionRoles & Responsibilities :We are looking for Senior Software Engineer who has experience in Web Back end development.Main responsibilitiesDesign and development Full stack application development (front end and back end) using .NET an ...
📑 Rivvun AI is looking for a hands-on AI Developer to design, build, and deploy the next generation of intelligent applications from the ground up. We aren't just plugging into APIs— we are building a scalable, secure, and reusable enterprise AI platform. Key Responsibili ...
📑 Sitecore - CREQ191985 Description 1. 5+ years of Sitecore experience, preferably Sitecore certified on and/or greater. Preferred to have experience on Sitecore and Headless JSS development. 2. Experience in Digital Marketing, Digital Asset Management, EXM, Analytics etc. 3.Experience with S ...
📑 About the company: One of the company offering a wide range of insurance products and services, including life insurance, disability income insurance.Experience:8+yrsLocation: ChennaiRoles and Responsibilities: Lead Full Stack Developer with expertise in C#/.NET Core ...
📑 months contract // to //Description:Bachelor's degree in computer science, Engineering, or a related field (or equivalent experience) and able to demonstrate high proficiency in programming fundamentals.At least years of proven working experience as a Full Stack Dev ...
📑 Hiring Alert | Application Support Engineer L2 (Qlik / Informatica / MuleSoft) Location: Gurugram (Work From Office) Experience: 47 Years Budget: INR 10 12 LPA We are looking for an experienced Application Support Engineer L2 to support enterprise analytics, ETL, and integration platforms for a leading client ...
📑 Senior Fullstack Lead – Legal AI Platform Full Time in Office - Bengaluru Build the future of legal tech. Own the development of new features across the stack, collaborate with a growing in-person Bangalore, India based team and deliver high‑quality software on time and on bud ...
📑 YASH Technologies is a leading technology integrator specializing in helping clients reimagine operating models, enhance competitiveness, optimize costs, foster exceptional stakeholder experiences, and drive business transformation. At YASH, we’re a cluster of the brightest stars working with cutting- ...
📑 At eBay, we're more than a global ecommerce leader — we’re changing the way the world shops and sells. Our platform empowers millions of buyers and sellers in more than 190 markets around the world. We’re committed to pushing boundaries and leaving our mark as we reinvent the future of ecommerce for enthusias ...
📑 Job Requirement: Typically requires a minimum of 8 years of related experience; or 6 years and an advanced degree. Bachelors degree in engineering, CS, physics, math, statistics, or another related field or equivalent work experience Proficient in coding and ext ...
📑 Job Requirement: Typically requires a minimum of 8 years of related experience; or 6 years and an advanced degree. Bachelors degree in engineering, CS, physics, math, statistics, or another related field or equivalent work experience Proficient in coding and ext ...
📑 Senior Fullstack Lead – Legal AI Platform Full Time in Office - Bengaluru Build the future of legal tech. Own the development of new features across the stack, collaborate with a growing in-person Bangalore, India based team and deliver high‑quality software on time and on bud ...
📑 Senior Fullstack Lead – Legal AI PlatformFull Time in Office - BengaluruBuild the future of legal tech. Own the development of new features across the stack, collaborate with a growing in-person Bangalore, India based team and deliver high‑quality software on time and on budget.About the ...
📑 At eBay, we're more than a global ecommerce leader — we’re changing the way the world shops and sells. Our platform empowers millions of buyers and sellers in more than 190 markets around the world. We’re committed to pushing boundaries and leaving our mark as we reinvent the future of ecommerce for enthusias ...
📑 Role Summary The Forward Deployed Engineer (FDE) sits at the intersection of AI engineering and client delivery. This is a hands-on, client-facing technical role responsible for architecting and building customized agentic solutions directly within client environments. The FDE does not hand off work to ...
📑 Job Title: Sr. Developer I (Java) - IT Manufacturing, SIOP & QualitySummary: We are seeking a passionate and highly skilled Java Full Stack Developer to join our global IT development and operations team. In this role, you will design, develop, enhanc ...
📑 Employment Type: Full Time Education Qualification: Bachelor's degree in Computer Science or related field or higher with minimum 4 years of relevant experience. Position Description:. 5 - 8 years of experience in implementation of Elastic Search based project development.Design and implement high ...
📑 Job Title: Sr. Developer I - IT Manufacturing, SIOP & QualitySummary: We are seeking a passionate and highly skilled Java Full Stack Developer to join our global IT development and operations team. In this role, you will design, develop, enhance, and ...
📑 Role Summary The Forward Deployed Engineer (FDE) sits at the intersection of AI engineering and client delivery. This is a hands-on, client-facing technical role responsible for architecting and building customized agentic solutions directly within client environments. The FDE does not hand off work to ...
📑 Role Summary The Forward Deployed Engineer (FDE) sits at the intersection of AI engineering and client delivery. This is a hands-on, client-facing technical role responsible for architecting and building customized agentic solutions directly within client environments. The FDE does not hand off work to ...
📑 Role SummaryThe Forward Deployed Engineer (FDE) sits at the intersection of AI engineering and client delivery. This is a hands-on, client-facing technical role responsible for architecting and building customized agentic solutions directly within client environments. The FDE does not hand off work to ...
📑 Role SummaryThe Forward Deployed Engineer (FDE) sits at the intersection of AI engineering and client delivery. This is a hands-on, client-facing technical role responsible for architecting and building customized agentic solutions directly within client environments. The FDE does not hand off work to ...
📑 Role SummaryThe Forward Deployed Engineer (FDE) sits at the intersection of AI engineering and client delivery. This is a hands-on, client-facing technical role responsible for architecting and building customized agentic solutions directly within client environments. The FDE does not hand off work to ...
📑 Role Summary The Forward Deployed Engineer (FDE) sits at the intersection of AI engineering and client delivery. This is a hands-on, client-facing technical role responsible for architecting and building customized agentic solutions directly within client environments. The FDE does not hand off work to ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,709,450+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Sitecore | Virtusa | Full-time |
| Head-Marketing | CIEL HR | Full-time |
| Site Reliability Engineer | First Tek | Full-time |
| .Net Fullstack-React | Saaki Argus & Averil Consulting | Full-time |
| Senior Java Fullstack Developer... | Mindera | Full-time |
| Group Marketing Manager (B2B Industrial) | Blue Genes Research | Full-time |
| Manager/ sr. manager digital marketing | VEGA | Full-time |
| Assistant professor - cse | Anand International College Of Engineering, Jaipur | Full-time |
| Ai/ml engineer (for a product based company) | Crystal Peak | Full-time |
| AWS DEVOPS | LTM | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!