📑 Full Stack Developer (Remote/WFH)Work Duration:- Monday to Friday, 8:30am to 6:00pm (GMT +8)Salary Range:- $1,200 – $1,500 (SGD)Role Overview:We are seeking a skilled Full Stack Developer capable of driving end-to-end web application development. The ideal candidate will be ...
📑 Minimum of 6 years experience as a Java Full Stack Developer with hands-on experience in Spring, Micro Services, Java, and Spring Boot Develop user interfaces using HTML, CSS, and JavaScriptUse JavaScript frameworks/libraries like Angular, React, or Vue.js for building dynamic and interacti ...
📑 Description Responsible for developing, enhancing, modifying and/or maintaining applications in the Enterprise Risk Technology environment. Software developers design, code, test, debug and document programs as well as support activities for the corporate systems architecture.Em ...
📑 Company DescriptionAbout us: Passion for food. Hunger for tech. We make METRO digital. Today technology is driving the world. And at METRO.digital we are driving the technology for one of the leading international wholesalers specializing in food - METRO. From e-comm ...
📑 Genpact (NYSE: G) is a global professional services and solutions firm delivering outcomes that shape the future. Our 125,000+ people across 30+ countries are driven by our innate curiosity, entrepreneurial agility, and desire to create lasting value for clients. We dream in digital, dare, and reinvent the wa ...
📑 Roles & Responsibilities:-Operating a Hybrid Cloud with Microsoft Azure Stack? – Certified Lead and inspire a team of Backend Engineers in the Europe & India to deliver world class services Help product teams to develop and deploy on a cloud native environment Ensure all ke ...
📑 Job Title: Founding Full Stack Location: Bangalore Experience: 2 to 6 yearsThe RoleWe're hiring a Founding Full Stack Engineer to join our lean team out of our Bangalore ...
📑 Position Description: We are looking for a Full Stack Developer with strong expertise in Java, JavaScript, Angular, Spring Framework, and REST APIs. The candidate should have hands-on experience with MongoDB, Oracle DB, Kafka, APIGEE, Linux, and Jenkins for building scalable enterprise ap ...
📑 Smart Ship Hub DigitalSingapore | Japan | India</str ...
📑 AHEAD builds platforms for digital business. By weaving together advances in cloud infrastructure, automation and analytics, and software delivery, we help enterprises deliver on the promise of digital transformation.At AHEAD, we prioritize creating a culture of belonging, where all perspectives and voices are r ...
📑 Candidate should be able to: Design and develop microservices using node.js. Participate in agile development processes in SDLC, including sprint planning, iterative development, estimations, and design sessions Communicate effectively across desks, teams, and departments Develop clean, mo ...
📑 About Us:We are a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, ...
📑 Skillset:● Strong proficiency in full stack development (NOSQL, React , Next.js, Lambda)● Solid understanding of REST APIs, authentication, and integration patterns● Experience working with CRMs (Insightly preferred, Salesforce/HubSpot acceptable)● Strong debugging ...
📑 Position Description: Founded in , CGI is among the largest independent IT and business consulting services firms in the world. With 94, consultants and professionals across the globe, CGI delivers an end-to-end portfolio of capabilities, from strategic IT and business consulting to syste ...
📑 Job Description Description: Skills / Competencies: • C#.Net , asp.net webform,MVC ,Jquery,Java script,MS SQL DML,Web Service/Web API………………….Secondary Skills :. HTML5 , Azure, node.js, SOA,N-Tier ,Micro Service, Multi-Tenant SAAS . Like to have skills :. Agile Scrum, TFS. ...
📑 Job Title : Java Full Stack Developer Experience : 3 to 5 Years Work Mode : Remote Notice Period : Immediate Joiners Preferred Job Description: We are looking ...
📑 Responsible for leading and mentoring development teams, collaborating on requirements, architecting and implementing scalable microservices, ensuring code quality and security, troubleshooting and testing solutions, managing priorities, overseeing demo content, facilitating cross-team communication, coordina ...
📑 Responsible for collaborating with advisors to define solution designs, developing scalable and high-performing code, ensuring code quality and security, leading code reviews, managing priorities, facilitating cross-team communication, acting as a demo content owner, mentoring junior developers, and supportin ...
📑 Full Stack Engineering Manager Bangalore, India | R&D Share position At JFrog, we're reinventing DevOps to help the world's greatest companies innovate – and we want you along for the ride. This is a special place with a unique combination of brilliance, spirit and just all-around great p ...
📑 <ul> <li>Strong experience in .NET development, including Azure Functions and Console Applications.</li> <li>Proficiency in Angular (latest versions) for developing modern, responsive web applications.</li> ...
📑 Full Stack Developer (C#)The Treasury Technology team at Millennium is responsible for developing and supporting wide range of software product and services across Treasury ecosystems. In this role, you will work on sophisticated software systems that support our firm’s liquidity management and financing stra ...
📑 Job DescriptionWhat we want: Seeking a Full-Stack Developer Fresher with basic knowledge of Node.js, React.js, MySQL/PostgreSQL, and Microservices Architecture. The ideal candidate should be enthusiastic about web development, eager to learn, and ...
📑 What this Job Entails: We are seeking an experienced Full Stack Engineer with a minimum of 5 yearsof expertise in Core Java development on a Cloud environment. The idealcandidate should possess a deep understanding of full-stack developmentusing Java, REST APIs, and Containerizati ...
📑 The VNDLY & Workday Developer is responsible for designing, configuring, and supporting integrations, workflows, and functional enhancements across the VNDLY Vendor Management System (VMS) and the Workday HCM/Extended Modules.This role ensures seamless data flow between VNDLY, Workday, and downstream sys ...
📑 Job DescriptionWe are looking for a skilled Full Stack Web Developer who has strong expertise in React.js, Node.js, and modern web technologies. The ideal candidate should be capable of designing, developing, and maintaining both front-end and ...
📑 Candidate should be able to: • Provide technical mentorship and ensure that code is developed to standards. Lead Code reviews. • Develop Project Scope Documentation to include deliverables, timelines, and budget. Work with the Project Manager and Business stakeholders to develop the desired solution. ...
📑 Job Description We are expanding our engineering team and is looking for a highly skilled Senior Full Stack Developer who can take ownership, deliver quality, and work across the stack with confidence.Role: Senior Full Stack DeveloperExperience: 8–10 years Openings ...
📑 We are presently looking for a Senior Full Stack Developer with over 6 years experience to become part of our agile Sports. We’re looking for people with great programming skills that are quick learners, self-starters, and take ownership of their work. Our systems are largely built using client side frameworks s ...
📑 • 10+ years in development Software solutions • Expert working knowledge of C# and .Net • Expert database skills within any RDBMS systems, primarily SQL Server • Experience in web development, mostly with SPA frameworks angular and angular JS, JavaScript, NBC, soap/rest web services • Financi ...
📑 About Us:We ae a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, ...
📑 Job Description: Minimum Qualification: B.E. or Diploma in Electronics/Electrical and Computer Science/Engineering or similar field from an accredited university with minimum 4-10 years of relevant experience Must ha ...
📑 About Us:We ae a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, ...
📑 About this opportunity As a Sr. Full Stack Developer, you will work with a cross-functional agile team. Support existed and create new functionality from scratch, participate in architecture discussions, develop web applications following the up-to-date web standards, APIs and integrations. ...
📑 java Full Stack Developer - CREQ193325 Description Full Stack Developer Resource should be having 3 years of knowledge or experience working in Banking Domain Should have strong understanding of SDLC Must have excellent analytical Skills Good knowledge of Angular, Java, Oracle SQL Must ...
📑 Job Title: Senior Full Stack Developer Job Type: Permanent Experience: Minimum 6 years of relevant experience Location: Hyderabad Job Brief We are looking for a pa ...
📑 About Us:We are a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, ...
📑 About Affinity Affinity is pioneering new frontiers in AdTech by building privacy-first advertising infrastructure that helps publishers maximize monetization and enables advertisers to reach the right audiences beyond walled gardens. Operating across 10+ markets in Asia, the US, and Europe, wi ...
📑 Full Stack Web Developer - CREQ192066 Description Full Stack Web Developer Expert Full Stack Web Developer should be a technical expert who can design and implement end to end web applications. He / She should Participate in requirement discussions, analyze and understand the end users need a ...
📑 Role: Java with Angular Skill set: Java, Angular, Spring Boot, AWS, MicroservicesRole DescriptionDesign, develop, and maintain Java-based applications using Spring Boot and Angular.Buil ...
📑 Job Description We’re AtkinsRéalis, a world-leading Design, Engineering and Project Management organization. Created by the integration of long-standing organizations dating back to 1911, we are a world-leading professional services and project management company dedicated to engin ...
📑 We are looking for passionate and skilled Full Stack Developers to join our dynamic product engineering team.You’ll work closely with architects, designers, and product managers to build high-quality, scalable, andperformant web applications using Angular (v20) and (v22).As part of our agile team ...
📑 Be part of a fast-growing Tech team at a global capital management platformA fully remote opportunity with the chance to collaborate with a global teamAbout Our ClientThe company is a global alternative investment and capital management platform with deep expertise acros ...
📑 Job Description Hiring: Java Full Stack Developer | Remote (PAN India)We are looking for experienced Java Full Stack Developers for a remote opportunity with a leading client. Experience: 7–10+ Years Location: PAN I ...
📑 React Full-stack EngineerReact, C#, .NET, REST API Development, Azure Resources, SQL & NoSQLEnglish Communication, Unit Testing, Travel Ecosystem Knowledge (Plus)Senior 10+ Years ...
📑 Job DescriptionFull-Stack ...
📑 Junior Full-Stack Developer Location: BengaluruEmployment Type: Full-Time Experience Level: Junior (1-2 years) About Acowale We're building Acodash - the world's first AI-powered Sm ...
📑 Sr Full Stack EngineerRole Summary We are looking for a hands-on Full Stack Engineer to design, build, test, and maintain modern web applications using a full-stack engineering approach. The role requires strong software development fundamentals, practical experience delivering production-g ...
📑 <p>Responsible for leading and mentoring development teams, collaborating on requirements, architecting and implementing scalable microservices, ensuring code quality and security, troubleshooting and testing solutions, managing priorities, overseeing demo content, facilitating cross-team communication, co ...
📑 Candidate should be able to: • Provide technical mentorship and ensure that code is developed to standards. Lead Code reviews. • Develop Project Scope Documentation to include deliverables, timelines, and budget. Work with the Project Manager and Business stakeholders to develop the desired solution. ...
📑 We are looking for an experienced Technical Lead with 10+ years of full-stack development expertise in Java (Spring Boot) and Node.js to drive the design and delivery of scalable, high-performance applications in the banking doma ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,494,382+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Full Stack DeveloperRemote/WFH | Fuku | Full time |
| Full Stack Java Developer | Miracle Software Systems | Full Time |
| Full Stack Engineer, AVP | F335 Deutsche India Private Limited, Bangalore Branch | Full time |
| Full Stack MuleSoft Engineer | METRO LOGISTICS | Full-time |
| Consultant – Full Stack Developer | Genpact | Full-time |
| Full Stack Development-Web | ASL HR Solution | Full-time |
| Linkrunner- Full Stack Developer | Nexthire | Full Time |
| Java Full stack Developer | CGI | Full Time |
| Java Full Stack Developer | Smart Ship Hub | Full-time |
| Full Stack Engineer - SNAP | AHEAD | Full Time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!