1,709,441+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

AWS DEVOPS

📑 Seeking a Specialist with 5 to 7 years of experience in automation within FullStack Engineering focused on System Integration and Deployment Job Description Design develop and implement automated solutions to streamline system integration and deployment processes Collaborate with cros ...

Senior Platform Engineer

📑 The Job in Short - The Platform Engineer is an infrastructure specialist focused on providing shared foundations across teams within a Value Stream. You design and deliver organization-wide SDLC technical improvements and reduce toil through automation. You act as the bridge between development ...

AI/ML Engineer (For a Product based Company)

📑 Role: AI/ML EngineerLocation: Noida/ BLR/ PuneWe are hiring AI/ML Engineers for Product based company in Insurance domain to build accelerators, data products, and AI-infused tools. This is an opportunity to build cutting-edge AI solutions that transform insurance operations- from underwriting auto ...

AWS DEVOPS

📑 Seeking a Specialist with 5 to 7 years of experience in automation within FullStack Engineering focused on System Integration and DeploymentJob DescriptionDesign develop and implement automated solutions to streamline system integration and deployment processes Collaborate with crossf ...

Embedded Engineer

📑 About QpiAIAt QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible f ...

Hardware Software Integration Engineer

📑 About QpiAIAt QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible f ...

Assoc. Manager, Engineering

📑 Private and public cloud with OpenShift, Quarkus, Kubernetes and Docker (S-Kube Amadeus framework to write Cloud Native Applications based on micro services) Mixed Event Driven and Service Oriented Architecture Kafka streaming technology Open API with REST JSON over HTTPS ...

Senior Fullstack Developer Java/Angular

📑 German Based Industrial AutomationTechnology Engineering Center in Bangalore is very dynamic and rapidly growingAbout Our ClientThe company is a well-established, large-sized organization operating in the Industrial Automation industry. It is known for its innovative sol ...

Embedded Engineer

📑 About QpiAI At QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible for desig ...

Storage & Server Engineer

📑 Hiring: Storage & Server EngineerLocation: BangaloreExperience: 4–8 Years Budget: upto 10 lpa Employment Type: Full-Time ...

Sr Software Developer (Kotlin, VUE,...

📑 Candidate should be able to: Ensure quality by performing thorough testing and leveraging peer reviews for your work and the work of cross-functional teams Implement excellent end-user experiences, continually raising the bar on functionality, usability, and simplicity Drive robust, maintainable, ...

Architect C++/Java

📑 Minimum of 12+ years of experience with technical hands-on in full-stack development & helping other team members SDLC Toolchain experience Experience in the design and development of high-performing solutions Knowledge of Azure Cloud and related technologies (Cloud native design, ...

Associate Software Engineer

📑 Associate Software EngineerIn this role you will:Write high-quality, efficient, testable code in Microsoft.Net, .Net Core, Angular and other object-oriented languages.Be a full stack web developer with a strong inclination towards software design & principles. P ...

SDE II

📑 Roles & Responsibilities: Actively drive discussions to improve product across engineering teams, wherever there are interdependencies across products Understand well-defined business use cases / PRD and design the solution f ...

Software Engineer Java Fullstack

📑 Software Engineer - Java Fullstack Innovation / Project / Organization Permanent contract Bangalore, India Hybrid Reference 24000G6O Start date Immediately Publication date 2025/01/10 Responsibilities Java Full stack development of UI’s , RESTFUL APIs and proces ...

Technical Lead

📑 Job Description Job descriptionWe are looking for an experienced, self-driven and motivated Team Leader to join our team! As our Team Leader, you will be responsible for supervising, overseeing, leading, managing, rewarding and motivating various company’s teams ...

Staff Software Engineer

📑 About McKesson Compile Established in 1833, McKesson is a US Fortune 10 global leader in healthcare supply chain management solutions, retail pharmacy, healthcare technology, community oncology, and specialty care. We partner with life sciences companies, manufacturers, providers, pharmacies, ...

Principal Engineer

📑 At ABB, we help industries run leaner and cleaner—and every person here makes that happen. You’ll be empowered to lead, supported to grow, and proud of the impact we create together. Join us and help run what runs the world. This Position reports to: R&D Team Manager What we b ...

Principal Engineer

📑 At ABB, we help industries run leaner and cleaner—and every person here makes that happen. You’ll be empowered to lead, supported to grow, and proud of the impact we create together. Join us and help run what runs the world.This Position reports ...

Staff Software Engineer

📑 About McKesson Compile Established in 1833, McKesson is a US Fortune 10 global leader in healthcare supply chain management solutions, retail pharmacy, healthcare technology, community oncology, and specialty care. We partner with life sciences companies, manufacturers, providers, pharmacies, go ...

AUTOSAR 4.5 BSW COM Development Engineer

📑 Job Description: Sr. AUTOSAR 4.5 BSW COM Development Engineer Experience Range 6 to 12 years of relevant automotive embedded development experience Role Overview We are seeking a highly skilled AUT ...

Senior gtm data engineer

📑 About the RoleAs the GTM Data Engineer, you will be responsible for integrating the revenue stack and building and optimizing the robust and scalable data pipelines that fuel the GTM system. You will be architecting the engine that powers our sales funnel, marketing attribution, and customer health scorin ...

Senior gtm data engineer

📑 About the RoleAs the GTM Data Engineer, you will be responsible for integrating the revenue stack and building and optimizing the robust and scalable data pipelines that fuel the GTM system. You will be architecting the engine that powers our sales funnel, marketing attribution, and customer health scorin ...

Elk Admin

📑 Greetings from Tata Consultancy Services!Role: ELK AdminExperience: 5+ yearsLocation: PuneKey Responsibilities:1. Elastic Stack Infrastructure- Design and setup Elastic S ...

LLM Solutions Developer

📑 Greetings from Tata Consultancy Services!Role: ELK AdminExperience: 5+ yearsLocation: PuneKey Responsibilities:1. Elastic Stack Infrastructure- Design and setup Elastic S ...

ELK Admin

📑 Greetings from Tata Consultancy Services! Role: ELK Admin Experience: 5+ years Location: Pune Key Responsibilities: 1. Elastic Stack Infrastructure - Design and setup Elastic Stack tools for monitoring critical applic ...

Machine Learning and AI Engineer

📑 Greetings from Tata Consultancy Services!Role: ELK AdminExperience: 5+ yearsLocation: PuneKey Responsibilities:1. Elastic Stack Infrastructure- Design and setup Elastic S ...

Software Engr II

📑 We are seeking a highly Skilled Senior Software Engineer with a strong full-stack development background in .Net and angular to join our innovative engineering team. With over 5 years of experience, you will be developing complex software solutions and drive technological advancements within our organization.<br ...

Software Engr II

📑 We are seeking a highly Skilled Senior Software Engineer with a strong full-stack development background in .Net and angular to join our innovative engineering team. With over 5 years of experience, you will be developing complex software solutions and drive technological advancements within our organization.<br ...

Senior AI/ML Engineer

📑 The Role: We are hiring a Senior Machine Learning Engineer to own the ML layer of an early-stage generative video product end-to- end. The role covers model selection and benchmarking, building the core generative agents, the video analysis pipeline, fine-tuning experiments, and the training-data strategy. A lar ...

Platform and DevOps

📑 Tracfox is hiring Builders with an expertise in Platform and Devops. Most code in modern engineering teams is now written by frontier agents. We hire the people who own the harness that makes that safe at a regulated-product bar. Lean team, visible impact, merit-driven, we grow people from within as we scale, n ...

Engineering Manager Frontend

📑 SR.Engineering Manager – Web Portal About the Role We are looking for an Engineering Manager – Web Portal (Frontend) to lead the design, development, and scaling of high-traffic web platforms supporting Mutual Funds, Trading, Research and others web ...

Engineering Manager Frontend

📑 SR.Engineering Manager – Web Portal About the Role We are looking for an Engineering Manager – Web Portal (Frontend) to lead the design, development, and scaling of high-traffic web platforms supporting Mutual Funds, Trading, Research and others web ...

Engineering Manager Frontend

📑 SR.Engineering Manager – Web Portal About the Role We are looking for an Engineering Manager – Web Portal (Frontend) to lead the design, development, and scaling of high-traffic web platforms supporting Mutual Funds, Trading, Research and others web portals. This role ...

QA Engineer

📑 SimpliSafe:We are the fastest growing home security company in the country competing against the entrenched giants, like ADT, and the new-to-the-space giants, like Amazon and Google. To compete in this ever growing IoT home automation security space we must learn and iterate quickl ...

Lead Engineer

📑 ABOUT YUBI Yubi (formerly CredAvenue) is redefining global debt markets by freeing the flow of finance between borrowers, lenders, and investors — the world's possibility platform for the discovery, investment, fulfilment, and collection of any debt solution. In March 2022, we became India's fa ...

Data Engineer Lead

📑 Role Overview We are seeking a Delivery Lead to lead the end‑to‑end delivery of data platforms and web‑based data solutions. This role blends hands-on data engineering expertise with strong delivery ownership and people leadership . The ideal candidate will manage a cro ...

AI / ML Architect

📑 Job Title: AI / ML Architect Location: Pune Experience required: 8+ years relevant The AI Engineer Architect plays a pivotal role in enabling safe responsible and enterprise ready AI adoption within the Exponential Engineer ...

Senior Data Engineer

📑 About the Company JMAN Group is a fast-growing data engineering & data science consultancy. We work primarily with Private Equity Funds and their Portfolio Companies to create commercial value using Data & Artificial Intelligence. In addition, we also work with growth businesses, larg ...

Senior Software Engineer

📑 Job Description :We are looking for a skilled and proactive Full Stack Senior .NET Engineer with 8+ years of experience to join the engineering team at ELLKAY Software Pvt. Ltd. Your position as a Senior Software Engineer will be instrumental in advanced development, testing ...

DevOps Engineer

📑 Your IT Future, Delivered DevOps Engineer With a global team of 5600+ IT professionals, DHL IT Services connects people and keeps the global economy running by continuously innovating and creating sustainable digit ...

CCTech Java Developer

📑 Role - Java Fullstack Developer About Us CCTech 's mission is to transform human life by the democratization of technology. We are a well established digital transformation company building the applications in the areas ...

Technical lead Fullstack (.Net & ReactJS)

📑 3Pillar warmly extends an invitation for you to join an elite team of visionaries. Beyond software development, we are dedicated to engineering solutions that challenge conventional norms. Envision you: steering projects that redefine urban living, establish new media channels for enterprise companies, or dri ...

Lead Engineer

📑 ABOUT YUBI Yubi (formerly CredAvenue) is redefining global debt markets by freeing the flow of finance between borrowers, lenders, and investors — the world's possibility platform for the discovery, investment, fulfilment, and collection of any debt solution. In March 2022, we became ...

Salesforce Engineer

📑 Ready to be a Titan? We are looking for a highly experienced and adaptable Salesforce Engineer with deep expertise in billing systems and a minimum of 3 years of Salesforce development experience. The ideal candidate is a hands-on engineer who can drive solution design and innovation, particula ...

Associate , BA D365 Enterprise Power Platform

📑 We are the leading provider of professional services to the middle market globally, our purpose is to instill confidence in a world of change, empowering our clients and people to realize their full potential. Our exceptional people are the key to our unrivaled, inclusive culture and talent experience and ou ...

Principal Associate Software Engineering Fullstack International Cardtech

📑 Overview Voyager (94001), India, Bangalore, KarnātakaPrincipal Associate - Software Engineering - Fullstack - International CardtechDo you love building and pioneering in the technology space? Do you enjoy solving complex business problems in a fast-paced, collaborative, inclusive, and ...

Senior mobile app dev react native

📑 We need a Senior Mobile App Lead Dev with 7+ years of experience to maintain, optimize, and extend our existing enterprise mobile application. This role requires hands-on expertise with camera-based scanning workflows (QR/barcodes) and libraries such as Vision Camera , AI integrations , and APIs . <b ...

Senior mobile app dev react native

📑 We need a Senior Mobile App Lead Dev with 7+ years of experience to maintain, optimize, and extend our existing enterprise mobile application. This role requires hands-on expertise with camera-based scanning workflows (QR/barcodes) and libraries such as Vision Camera , AI integrations , and APIs . </p ...

Senior mobile app dev react native

📑 We need a Senior Mobile App Lead Dev with 7+ years of experience to maintain, optimize, and extend our existing enterprise mobile application. This role requires hands-on expertise with camera-based scanning workflows (QR/barcodes) and libraries such as Vision Camera , AI integrations , and APIs . </p ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,709,441+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
AWS DEVOPS LTM Full-time
Senior Platform Engineer Backbase Full-time
AI/ML Engineer (For a Product based Company) Crystal Peak Full-time
AWS DEVOPS LTM Full-time
Embedded Engineer QpiAI Full-time
Hardware-Software Integration Engineer QpiAI Full-time
Assoc. Manager, Engineering ScaleneWorks Full-time
Senior Fullstack Developer - Java/Angular Michael Page Temporary
Embedded Engineer QpiAI Full-time
Storage & Server Engineer Vrinda International Full-time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!