📑 Technical Program Manager (TPM)Experience: 8–10 YearsWe are looking for a Technical Program Manager with strong expertise in AWS and/or Azure, Microsoft technology stack, Open Source technologies, and AI/ML solutions.Key Responsibilities- Manage end-to-end delivery of Cloud, . ...
📑 Scope of Role-The DVA Engineer is responsible for Dimensional Variation Analysis and Tolerance stack up for ongoing and new projects.Knowledge / Experience: 2+ YearsArea of Responsibility:·DVA Engineer creates and maintains analysis models represent ...
📑 Technical Program Manager (TPM)Experience: 8–10 YearsWe are looking for a Technical Program Manager with strong expertise in AWS and/or Azure, Microsoft technology stack, Open Source technologies, and AI/ML solutions.Key Responsibilities- Manage end-to-end delivery of Cloud, . ...
📑 Technical Program Manager (TPM)Experience: 8–10 YearsWe are looking for a Technical Program Manager with strong expertise in AWS and/or Azure, Microsoft technology stack, Open Source technologies, and AI/ML solutions.Key Responsibilities- Manage end-to-end delivery of Cloud, . ...
📑 About McKesson Compile Established in 1833, McKesson is a US Fortune 10 global leader in healthcare supply chain management solutions, retail pharmacy, healthcare technology, community oncology, and specialty care. We partner with life sciences companies, manufacturers, providers, pharmacies, go ...
📑 At ABB, we help industries run leaner and cleaner—and every person here makes that happen. You’ll be empowered to lead, supported to grow, and proud of the impact we create together. Join us and help run what runs the world.This Position reports ...
📑 At ABB, we help industries run leaner and cleaner—and every person here makes that happen. You’ll be empowered to lead, supported to grow, and proud of the impact we create together. Join us and help run what runs the world. This Position reports to: R&D Team Manager What we b ...
📑 About McKesson Compile Established in 1833, McKesson is a US Fortune 10 global leader in healthcare supply chain management solutions, retail pharmacy, healthcare technology, community oncology, and specialty care. We partner with life sciences companies, manufacturers, providers, pharmacies, ...
📑 Seeking a Specialist with 5 to 7 years of experience in automation within FullStack Engineering focused on System Integration and DeploymentJob DescriptionDesign develop and implement automated solutions to streamline system integration and deployment processes Collaborate with crossf ...
📑 About QpiAI At QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible for desig ...
📑 About QpiAIAt QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible f ...
📑 Seeking a Specialist with 5 to 7 years of experience in automation within FullStack Engineering focused on System Integration and Deployment Job Description Design develop and implement automated solutions to streamline system integration and deployment processes Collaborate with cros ...
📑 About QpiAIAt QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible f ...
📑 Role: AI/ML EngineerLocation: Noida/ BLR/ PuneWe are hiring AI/ML Engineers for Product based company in Insurance domain to build accelerators, data products, and AI-infused tools. This is an opportunity to build cutting-edge AI solutions that transform insurance operations- from underwriting auto ...
📑 German Based Industrial AutomationTechnology Engineering Center in Bangalore is very dynamic and rapidly growingAbout Our ClientThe company is a well-established, large-sized organization operating in the Industrial Automation industry. It is known for its innovative sol ...
📑 Hiring: Storage & Server EngineerLocation: BangaloreExperience: 4–8 Years Budget: upto 10 lpa Employment Type: Full-Time ...
📑 Software Engineer - Java Fullstack Innovation / Project / Organization Permanent contract Bangalore, India Hybrid Reference 24000G6O Start date Immediately Publication date 2025/01/10 Responsibilities Java Full stack development of UI’s , RESTFUL APIs and proces ...
📑 Roles & Responsibilities: Actively drive discussions to improve product across engineering teams, wherever there are interdependencies across products Understand well-defined business use cases / PRD and design the solution f ...
📑 Candidate should be able to: Ensure quality by performing thorough testing and leveraging peer reviews for your work and the work of cross-functional teams Implement excellent end-user experiences, continually raising the bar on functionality, usability, and simplicity Drive robust, maintainable, ...
📑 About QpiAIAt QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible for designi ...
📑 The Job in Short - The Platform Engineer is an infrastructure specialist focused on providing shared foundations across teams within a Value Stream. You design and deliver organization-wide SDLC technical improvements and reduce toil through automation. You act as the bridge between d ...
📑 Associate Software EngineerIn this role you will:Write high-quality, efficient, testable code in Microsoft.Net, .Net Core, Angular and other object-oriented languages.Be a full stack web developer with a strong inclination towards software design & principles. P ...
📑 Minimum of 12+ years of experience with technical hands-on in full-stack development & helping other team members SDLC Toolchain experience Experience in the design and development of high-performing solutions Knowledge of Azure Cloud and related technologies (Cloud native design, ...
📑 Private and public cloud with OpenShift, Quarkus, Kubernetes and Docker (S-Kube Amadeus framework to write Cloud Native Applications based on micro services) Mixed Event Driven and Service Oriented Architecture Kafka streaming technology Open API with REST JSON over HTTPS ...
📑 The Job in Short - The Platform Engineer is an infrastructure specialist focused on providing shared foundations across teams within a Value Stream. You design and deliver organization-wide SDLC technical improvements and reduce toil through automation. You act as the bridge between development ...
📑 About QpiAI At QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible for desig ...
📑 Seeking a Specialist with 5 to 7 years of experience in automation within FullStack Engineering focused on System Integration and Deployment Job Description Design develop and implement automated solutions to streamline system integration and deployment processes Collaborate with cros ...
📑 Seeking a Specialist with 5 to 7 years of experience in automation within FullStack Engineering focused on System Integration and Deployment Job Description Design develop and implement automated solutions to streamline system integration and deployment processes Collaborate with cros ...
📑 Seeking a Specialist with 5 to 7 years of experience in automation within FullStack Engineering focused on System Integration and DeploymentJob DescriptionDesign develop and implement automated solutions to streamline system integration and deployment processes Collaborate with crossf ...
📑 About QpiAIAt QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible f ...
📑 About QpiAI At QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible ...
📑 About QpiAI At QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible for desig ...
📑 About QpiAI At QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. Job Description: We are seeking a skilled and motivated Hardware Desig ...
📑 About QpiAIAt QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible f ...
📑 About the RoleWe are seeking a highly skilled Senior Consultant – Generative AI with strong full-stack development expertise and hands-on experience in AI/ML and Generative AI technologies. The ideal candidate will have practical experience in building AI-powered solutions and integrating large language mode ...
📑 Company Description A3 CEND is a specialist employee and enterprise development company — combining people, data, and intelligent technology to make capability building personalised, scalable, and measurable. Role Description As the Founding Tech Lead at A3 CEND, you will be responsible for architect ...
📑 The Job in Short - The Platform Engineer is an infrastructure specialist focused on providing shared foundations across teams within a Value Stream. You design and deliver organization-wide SDLC technical improvements and reduce toil through automation. You act as the bridge between development ...
📑 About QpiAIAt QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible for designi ...
📑 About QpiAIAt QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible f ...
📑 About QpiAI At QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible for desig ...
📑 About QpiAIAt QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible f ...
📑 . Designation : AEM Developer Education: B.E/B.Tech Experience: 5-7 Years Location: Bangalore Roles & Responsibilities: Should be hands-on with full-stack development with experience in Component Development: Creating modu ...
📑 Job Description Job descriptionWe are looking for an experienced, self-driven and motivated Team Leader to join our team! As our Team Leader, you will be responsible for supervising, overseeing, leading, managing, rewarding and motivating various company’s teams ...
📑 Associate Software Engineer In this role you will: Write high-quality, efficient, testable code in Microsoft.Net, .Net Core, Angular and other object-oriented languages. Be a full stack web developer with a strong inclination towards software design & princip ...
📑 Software Engineer - Java Fullstack Innovation / Project / Organization Permanent contract Bangalore, India Hybrid Reference 24000G6O Start date Immediately Publication date 2025/01/10 Responsibilities Java Full stack development of UI’s , RESTFUL APIs and ...
📑 About QpiAI At QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible ...
📑 Minimum of 12+ years of experience with technical hands-on in full-stack development & helping other team members SDLC Toolchain experience Experience in the design and development of high-performing solutions Knowledge of Azure Cloud and related technologies (Cloud native design, m ...
📑 Roles & Responsibilities: Actively drive discussions to improve product across engineering teams, wherever there are interdependencies across products Understand well-defined business use cases / PRD and design the solution for the business cases ...
📑 About QpiAI At QpiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QpiAI is building a full stack Enterprise Quantum Computers. QpiAI Quantum hardware team is responsible ...
📑 Candidate should be able to: Ensure quality by performing thorough testing and leveraging peer reviews for your work and the work of cross-functional teams Implement excellent end-user experiences, continually raising the bar on functionality, usability, and simplicity Drive robust, maintainable, ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,786,996+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| AI/ML Project Delivery Manager | People Tech Group Inc | Full-time |
| Sr. Engineer - DVA | Tata Technologies | Full-time |
| Cloud Solutions Program Lead | People Tech Group Inc | Full-time |
| Technical Program Manager | People Tech Group Inc | Full-time |
| Staff Software Engineer | CPI McKesson Compile India Private Limited | Full time |
| Principal Engineer | ABB | Full Time |
| Principal Engineer | ABB | Full-time |
| Staff Software Engineer | CPI McKesson Compile India Private Limited | Full-time |
| AWS DEVOPS | LTM | Full-time |
| Embedded Engineer | QpiAI | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!