📑 Position Overview Autodesk is seeking a Senior Solution Architect to lead architecture and technical design for the Knowledge platform, a cloud-native knowledge and solution delivery platform built on AWS.Workflow Advisory enables Technical Advisory to publish, discov ...
📑 At TechBiz Global, we are providing recruitment service to our TOP clients from our portfolio. We are currently seeking a Full-stack developer to join one of our <span style=co ...
📑 At TechBiz Global, we are providing recruitment service to our TOP clients from our portfolio. We are currently seeking a Full-stack developer to join one of our <span style=co ...
📑 Job OverviewWe are looking for a Chemist for Air Monitoring and Sampling work at industrial sites. The role includes monitoring air parameters like PM, SO₂, and NOx, carrying monitoring equipment, and climbing stacks/chimneys when required. This is a combination of office and field work with site visit ...
📑 Job OverviewWe are looking for a Chemist for Air Monitoring and Sampling work at industrial sites. The role includes monitoring air parameters like PM, SO₂, and NOx, carrying monitoring equipment, and climbing stacks/chimneys when required. This is a combination of office and field work with site visit ...
📑 Job OverviewWe are looking for a Chemist for Air Monitoring and Sampling work at industrial sites. The role includes monitoring air parameters like PM, SO₂, and NOx, carrying monitoring equipment, and climbing stacks/chimneys when required. This is a combination of office and field work with site visit ...
📑 Job OverviewWe are looking for a Chemist for Air Monitoring and Sampling work at industrial sites. The role includes monitoring air parameters like PM, SO₂, and NOx, carrying monitoring equipment, and climbing stacks/chimneys when required. This is a combination of office and field work with site visit ...
📑 Job Overview We are looking for a Chemist for Air Monitoring and Sampling work at industrial sites. The role includes monitoring air parameters like PM, SO₂, and NOx, carrying monitoring equipment, and climbing stacks/chimneys when required. This is a combination of office and field work with site visi ...
📑 Job Title: GES CAD Powertrain team Requirement Experience: 2 - 4 Years Qualification: B.E/B.Tech or M.E/M.Tech (Electronics & Mechanical) Job Location: Chennai Job Description: Proficient in creatin ...
📑 At ABB, we help industries run leaner and cleaner—and every person here makes that happen. You’ll be empowered to lead, supported to grow, and proud of the impact we create together. Join us and help run what runs the world.This Position reports ...
📑 Key Responsibilities 1. Test Strategy & Execution Define and execute testing protocols with scientific rigor: establish electrochemistry-grounded hypotheses, design tests to validate or refute them, and quantify all findings (degradation rates, failure mechanisms, ...
📑 Description :We are seeking an experienced and dynamic Revenue Operations Leader to establish and drive our RevOps data and reporting center of excellence. This is a critical role that requires a strategic thinker with a proven track record in revenue operations, data management, and s ...
📑 Appy Before Position: Web Developer (Female Candidates Only) Location: Pune Experience: 1–2 years OR completed MERN Stack training/internship CTC Details: Probation Period (3 months): ₹8,000 – ₹10,000/month (based on skills ...
📑 Job Description: Sr. AUTOSAR BSW Diagnostics Development EngineerExperience Range -6 to 12 year s in automotive embedded software developmentRole OverviewWe are looking for an experiencedSr. AUTOSAR BSW Diagnostics Engin eer with strong expertisein Diagnostics, Fai ...
📑 Description :We are seeking an experienced and dynamic Revenue Operations Leader to establish and drive our RevOps data and reporting center of excellence. This is a critical role that requires a strategic thinker with a proven track record in revenue operations, data management, and sale ...
📑 Appy Before 25-06-2025Position: Web Developer (Female Candidates Only)Location: PuneExperience: 1–2 years OR completed MERN Stack training/internshipCTC Details: Probation Period (3 months): ₹8,000 – ₹10,000/month (based on ...
📑 **We help the world run better**At SAP, we keep it simple: you bring your best to us, and we'll bring out the best in you. We're builders touching over 20 industries and 80% of global commerce, and we need your unique talents to help shape what's next. The work is challenging – but it matters. You'll find a ...
📑 Job Description: The ideal candidate will have a strong understanding of Starlink Production Core Support . He will be responsible for Eyes on glass Monitoring, Triage & Incident Ownership, Troubleshooting & Restoration, Cross-Team Collaboration, Platform & Application Stack Aware ...
📑 Job Description:The ideal candidate will have a strong understanding of Starlink Production Core Support.He will be responsible for Eyes on glass Monitoring, Triage & Incident Ownership, Troubleshooting & Restoration, Cross-Team Collaboration, Platform & Application Stack Awareness ...
📑 Are you passionate about graphics systems and display technologies that power millions of devices? Join our team to work at the intersection of GPU drivers, display compositors, and system-level integration, delivering seamless visual experiences on cutting-edge consumer devices.As a SysDe I, you will ...
📑 Are you passionate about graphics systems and display technologies that power millions of devices? Join our team to work at the intersection of GPU drivers, display compositors, and system-level integration, delivering seamless visual experiences on cutting-edge consumer devices.As a SysDe I, you will ...
📑 Location: Bangalore Experience: 6 - 9 Years Must have Skills - Angular + Java (need expertise on both Tech stack), DevOps, CICD, Cloud. ...
📑 AVP –Sr. Engineer Job ID:R0425869 Full/Part-Time: Full-time Regular/Temporary: Regular Listed: 2026-04-22 Location: Pune Position OverviewJob Title: AVP –Sr. EngineerLocation: Pune, IndiaRole DescriptionWork closely with engineers and develop best technical design and implement high quality software solutions.Pr ...
📑 About Position:A .NET Full Stack and Agentic AI Architect is a senior-level role combining traditional enterprise application development with autonomous AI system design. This role is responsible for designing, developing, and deploying scalable, secure, and production-re ...
📑 About Position:A .NET Full Stack and Agentic AI Architect is a senior-level role combining traditional enterprise application development with autonomous AI system design. This role is responsible for designing, developing, and deploying scalable, secure, and production-re ...
📑 About Position:A .NET Full Stack and Agentic AI Architect is a senior-level role combining traditional enterprise application development with autonomous AI system design. This role is responsible for designing, developing, and deploying scalable, secure, and production-re ...
📑 About Position: A .NET Full Stack and Agentic AI Architect is a senior-level role combining traditional enterprise application development with autonomous AI system design. This role is responsible for designing, developing, and deploying scalable, secure, and production-ready applic ...
📑 **Introduction**A career in IBM Consulting is built on long-term client relationships and close collaboration worldwide. You’ll work with leading companies across industries, helping them shape their hybrid cloud and AI journeys. With support from our strategic partners, robust IBM technology, and Red Hat, y ...
📑 **Introduction**A career in IBM Consulting is built on long-term client relationships and close collaboration worldwide. You’ll work with leading companies across industries, helping them shape their hybrid cloud and AI journeys. With support from our strategic partners, robust IBM technology, and Red Hat, y ...
📑 **Introduction**A career in IBM Consulting is built on long-term client relationships and close collaboration worldwide. You’ll work with leading companies across industries, helping them shape their hybrid cloud and AI journeys. With support from our strategic partners, robust IBM technology, and Red Hat, y ...
📑 Systems, Automation & AI EngineerALIV Regenerative Wellness | Pune (primary) — remote-friendly for the right candidateAbout the roleALIV is scaling across three cities, multiple verticals (IV, peptides, ACT, PRP, exosomes), and an operational stack that already includes Zoh ...
📑 Systems, Automation & AI EngineerALIV Regenerative Wellness | Pune (primary) — remote-friendly for the right candidateAbout the roleALIV is scaling across three cities, multiple verticals (IV, peptides, ACT, PRP, exosomes), and an operational stack that already includes Zoh ...
📑 Systems, Automation & AI EngineerALIV Regenerative Wellness | Pune (primary) — remote-friendly for the right candidateAbout the roleALIV is scaling across three cities, multiple verticals (IV, peptides, ACT, PRP, exosomes), and an operational stack that already includes Zoh ...
📑 Systems, Automation & AI EngineerALIV Regenerative Wellness | Pune (primary) — remote-friendly for the right candidate About the roleALIV is scaling across three cities, multiple verticals (IV, peptides, ACT, PRP, exosomes), and an operational stack that already includes Zoho One, Make.c ...
📑 Systems, Automation & AI EngineerALIV Regenerative Wellness | Pune (primary) — remote-friendly for the right candidateAbout the roleALIV is scaling across three cities, multiple verticals (IV, peptides, ACT, PRP, exosomes), and an operational stack that already includes Zoh ...
📑 OverviewMicrosoft Industry Solution - Global Delivery Center (GDC) delivers end-to-end solutions by enabling accelerated adoption and productive use of Microsoft technologies. An organization of well over 1000+ exceptional people, GDC presents a great opportunity for highly skilled servic ...
📑 Staff Software Engineer, Play Games, Gamer Profile _corporate_fare_ Google _place_ Bengaluru, Karnataka, India **Advanced** Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep expertise in domain. **Minimum qualificatio ...
📑 Job Title: Software Engineer (Fullstack)Experience: 2+ YearsLocation: Bangalore (WFO) About the Company: Our client is a product-focused organization founded by experienced technocrats with over 14 years of collaboration and a combined industry experience of 1 ...
📑 About Company: A leading Business Process Management Company Position: Director/Senior Director Experience: 20+years Key Responsibilities: < ...
📑 Job Description: We are seeking a .NET Full Stack developer responsible for building .NETCore web applications (front-end and middle layer using C# language, back-end using SQL). The primary technology should be on SQL Server and .NET. The candidate should have good experience on Sql ...
📑 Job Title: Lead Engineer – Enterprise Network Operations Department: Engineering and Operations Location: Mumbai Reporting: Associate Director Network Operations Job Type: Full Time Shift: Rotational Shift PRE-REQUISITES Technical expertise on all or either of the following platform Cisco catalyst and Nexus swit ...
📑 The Database Administrator/ Data Security Engineer will have a strong background in securing and maintaining an enterprise cloud data environment. Cloud Security Engineers or Database Administrators (DBAs) with experience in Analytics Data Security will be strongly preferred. </p ...
📑 Interested in driving the next set of experiences on Alexa? We have a great opportunity for a Software Development Engineering to join our team and reimagine what world class software can be built to drive the next set of capabilities on Alexa. We are reinventing our technology stack and working hard, having fun ...
📑 Your Role :We are looking for a Senior Software Engineer to join our team. In this role, you’ll play a key part in developing solutions that enhance how our customers monitor, manage, and optimize their systems. You will contribute to building and delivering innovative products that seamlessly integra ...
📑 Role: HR Generalist Experience: Minimum 1 year Location: Kandivali West, Mumbai (on-site) We are a marketing technology startup based in Mumbai, helping SMEs and amp; Enterprises to build and maintain their marketing technology sta ...
📑 Company: Our client a leading Fintech organization. Responsibilities: Develop and execute the overall solution architecture strategy for the Large Transformation Project. Lead and manage a team of technical architects to design and build a scalab ...
📑 Apply Before: Experience: 8+years in IT Field Work Type: Remote (Night Shifts – aligned with US time zones) Work Model: Proxy-based | 4 hours/day | 20 hours/week Salary: ₹1,00,000/month (Fixed) Open Positions ...
📑 Immediate requirement, candidate with any ALM experience would suffice and should be able to join immediately. We are looking for an experienced Developer in any ALM tool who can do both configurations and customization. You'll be part of a team that's responsible for offering ALM services p ...
📑 Job Description Backend Development Design, develop, and maintain scalable applications using Java, J2EE, Spring, and Spring Boot Build and expose RESTful APIs and microservices architecture Implement business logic with strong adherence ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,467,184+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Senior Solution Architect | Autodesk | Full time |
| Fullstack developer (AIassisted development) | TechBiz Global GmbH | CDI |
| Fullstack developer (AIassisted development) | TechBiz Global GmbH | CDI |
| Air Quality Sampling Technician | Enviro Axis | Full-time |
| Environmental Monitoring Specialist | Enviro Axis | Full-time |
| Industrial Hygiene Chemist | Enviro Axis | Full-time |
| Chemist – Air Monitoring & Sampling | Enviro Axis | Full-time |
| Chemist – Air Monitoring & Sampling | Enviro Axis | Full-time |
| GES CAD Powertrain team Requirement | Satyam Venture Engineering Services | Full-time |
| Solution Engineer | ABB | Full Time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!