📑 About Pollax Pollax builds AI voice and text systems for customer support. We train and deploy speech and language models that power customer interactions for businesses. Role We are hiring a Machine Learning Intern to work with our ML team on training, fine-tuning, and deploying ...
📑 We are Lenovo. We do what we say. We own what we do. We WOW our customers.Lenovo is a US$69 billion revenue global technology powerhouse, ranked #196 in the Fortune Global 500, and serving millions of customers every day in 180 markets. Focused on a bold vision to deliver Smarter Technology for All, Lenovo h ...
📑 Job Title: GES MBSE VE/Propulsion Systems Team Requirement Experience: 6 - 10 Years Qualification: B.E/B.Tech or M.E/M.Tech (CSE, Embedded, ECE & Mechatronics) Job Location: Chennai Job Description: <li ...
📑 About Client We are a fast-moving global firm operating in the crypto market-making space (not an exchange), but focused on building next-gen high-frequency trading infrastructure for market making in various global exchanges. A Full Stack Developer at a ...
📑 Job Title: Senior RAN Engineer (TM500) Location:Bangalore (Hybrid) Experience: 10–20 Years Domain: 5G RAN / SmallCells / Protocol Stack Job Summary: We are looking for a Senior RANEngineer with strong expertise in TM500-based load and performancetesting in multi-UE environments. The candidate wil ...
📑 **This is a remote contract position**Required Skills & ExperienceStrong experience with React.js (hooks, state management, component architecture)Experience with Node.js for backend/API development or integrationExperience building and consuming REST a ...
📑 **This is a remote contract position**Required Skills & ExperienceStrong experience with React.js (hooks, state management, component architecture)Experience with Node.js for backend/API development or integrationExperience building and consum ...
📑 Job Title: Recruitment Consultant Location: Bangalore – Onsite (JP Nagar 8th Phase) Employment Type: Full-time Role Overview We are looking for a Recruitment Consultant who enjoys meaningful conversations with candidates , understands skill fitment deeply, and can represent client companies and roles in a consul ...
📑 Job Title: Recruitment Consultant Location: Bangalore – Onsite (JP Nagar 8th Phase) Employment Type: Full-time Role Overview We are looking for a Recruitment Consultant who enjoys meaningful conversations with candidates , understands skill fitment deeply, and can represent client companies and roles in a consul ...
📑 Assistant Architect-Blockchain (Associate Architect)_2539Overall Objectives of JobAs a Full Stack Lead, you will be a key technical leader responsible for guiding development teams, architecting scalable enterprise solutions, and ensuring successful de ...
📑 We are looking to hire a PAID Web Developer (Intern).Responsibilities:Extend functionality in Open Source Web Tools.Skills:Frontend & Backend Web Development.MERN StackTypescriptReact.jsNode.jsNext.jsDjango ...
📑 We are looking to hire a PAID Web Developer (Intern).Responsibilities:Extend functionality in Open Source Web Tools.Skills:Frontend & Backend Web Development.MERN StackTypescriptReact.jsNode.jsNext.jsDjango ...
📑 DescriptionAmazon strives to be Earth's most customer-centric company where people can find and discover virtually anything they want to buy online. By giving customers more of what they want – low prices, vast selection, and convenience – Amazon continues to grow and evolve as a world-class e-commerce platf ...
📑 DescriptionBuild the technical foundation powering audio advertising across Amazon Devices. Join Alexa Advertising to own critical infrastructure supporting audio ads on Echo devices and future sponsored audio content in Alexa+ conversations. You'll build scalable systems processing billions of ad o ...
📑 IND Staff Engineer, Infrastructure - GCC036We’re determined to make a difference and are proud to be an insurance company that goes well beyond coverages and policies. Working here means having every opportunity to achieve your goals – and to help others accomplish theirs, too. Join our team as we help shape ...
📑 About Meragi : We're Building India’s biggest wed-tech startup , set to revolutionise the Indian wedding industry . Meragi is a rapidly growing start up in India's thriving $50 billion wedding industry. As a full-stack technology platform, we revolutionize the way wedd ...
📑 Razorpod · Gurgaon · In-office (5 days) · Full-time About the role We're looking for a Head of UX Design to lead our design team and own the work end to end. At Razorpod, we don't just design something and walk away once it launches. We build living systems, design that k ...
📑 Job Overview We are looking for an experienced Freelance Data Engineer ll 6+ Yrs. of exp to join a high-performing engineering team working on scalable products for global enterprise clients. This role is ideal for professionals currently working in a 100% REMOTE set ...
📑 Job OverviewWe are looking for an experienced Freelance Data Engineer ll 6+ Yrs. of exp to join a high-performing engineering team working on scalable products for global enterprise clients. This role is ideal for professionals currently working in a 100% REMOTE setup ...
📑 Job OverviewWe are looking for an experienced Freelance Data Engineer ll 6+ Yrs. of exp to join a high-performing engineering team working on scalable products for global enterprise clients. This role is ideal for professionals currently working in a 100% REMOTE setup ...
📑 Job OverviewWe are looking for an experienced Freelance Data Engineer ll 6+ Yrs. of exp to join a high-performing engineering team working on scalable products for global enterprise clients. This role is ideal for professionals currently working in a 100% REMOTE setup ...
📑 Job OverviewWe are looking for an experienced Freelance Data Engineer ll 6+ Yrs. of exp to join a high-performing engineering team working on scalable products for global enterprise clients. This role is ideal for professionals currently working in a 100% REMOTE setup ...
📑 Job Overview We are looking for an experienced Freelance Data Engineer ll 6+ Yrs. of exp to join a high-performing engineering team working on scalable products for global enterprise clients. This role is ideal for professionals currently working in a 100% REMOTE setup and looking to ta ...
📑 Job OverviewWe are looking for an experienced Freelance Data Engineer ll 6+ Yrs. of exp to join a high-performing engineering team working on scalable products for global enterprise clients. This role is ideal for professionals currently working in a 100% REMOTE setup ...
📑 Job OverviewWe are looking for an experienced Freelance Data Engineer ll 6+ Yrs. of exp to join a high-performing engineering team working on scalable products for global enterprise clients. This role is ideal for professionals currently working in a 100% REMOTE setup ...
📑 About UsGramian Consultancy is a boutique consultancy specializing in IT professional services and engineering talent solutions. With a strong background in software engineering and leadership, we help companies build high-performing teams by matching them with professionals who truly ...
📑 About Position: A .NET Full Stack and Agentic AI Architect is a senior-level role combining traditional enterprise application development with autonomous AI system design. This role is responsible for designing, developing, and deploying scalable, secure, and production-re ...
📑 Implementation Engineer Department Engineering – IoT & Hardware Experience Location - Hyderabad, India Employment Type 2–5 Years Full-Time ZestIoT Technologies builds intelligent software for aviation ground operations. Our IoT layer is the foundation of real-time equipment tracking — powering arrival and depart ...
📑 Project Role : Responsible AI EngineerProject Role Description : Assess AI systems for adherence to predefined thresholds and benchmarks related to responsible, ethical and sustainable practices. Design and implement technology mitigation strategies for systems to ensure ethical and responsi ...
📑 Job Summary: We are seeking a highly skilled and motivated Senior Software Developer to join our dynamic team. In this role, you will be responsible for designing, developing, and maintaining high-quality software solutions tailored to meet our clients' needs. You will collaborate cl ...
📑 Job Summary: We are seeking a highly skilled and motivated Senior Software Developer to join our dynamic team. In this role, you will be responsible for designing, developing, and maintaining high-quality software solutions tailored to meet our clients' needs. You will collaborate cl ...
📑 Description In this role, you will be helping a team responsible for building tools for engineers, platform wide improvements, driving digital transformation etc. You will work with business leaders/technology partners to create the product road map and manage any product changes through ...
📑 Description In this role, you will be helping a team responsible for building tools for engineers, platform wide improvements, driving digital transformation etc. You will work with business leaders/technology partners to create the product road map and manage any product changes through ...
📑 Description In this role, you will be helping a team responsible for building tools for engineers, platform wide improvements, driving digital transformation etc. You will work with business leaders/technology partners to create the product road map and manage any product changes through ...
📑 About Position: A .NET Full Stack and Agentic AI Architect is a senior-level role combining traditional enterprise application development with autonomous AI system design. This role is responsible for designing, developing, and deploying scalable, secure, and production-re ...
📑 Job Title:Senior Backend EngineerLocation:BangaloreExperience Level:Senior (8+ years)About the RoleWe are looking for an exceptional Senior Backend Engineer to join our Bangalore office. This is not a role for someone looking to execute tickets handed down from ...
📑 About Position:A .NET Full Stack and Agentic AI Architect is a senior-level role combining traditional enterprise application development with autonomous AI system design. This role is responsible for designing, developing, and deploying scalable, secure, and production-read ...
📑 About Position: A .NET Full Stack and Agentic AI Architect is a senior-level role combining traditional enterprise application development with autonomous AI system design. This role is responsible for designing, developing, and deploying scalable, secure, and production-re ...
📑 Job Title:Senior Backend EngineerLocation:BangaloreExperience Level:Senior (8+ years)About the RoleWe are looking for an exceptional Senior Backend Engineer to join our Bangalore office. This is not a role for someone looking to execute tickets handed down from ...
📑 Job Summary: We are seeking a highly skilled and motivated Senior Software Developer to join our dynamic team. In this role, you will be responsible for designing, developing, and maintaining high-quality software solutions tailored to meet our clients' needs. You will collaborate ...
📑 Description In this role, you will be helping a team responsible for building tools for engineers, platform wide improvements, driving digital transformation etc. You will work with business leaders/technology partners to create the product road map and manage any product changes through the ...
📑 Description In this role, you will be helping a team responsible for building tools for engineers, platform wide improvements, driving digital transformation etc. You will work with business leaders/technology partners to create the product road map and manage any product changes through the ...
📑 Description In this role, you will be helping a team responsible for building tools for engineers, platform wide improvements, driving digital transformation etc. You will work with business leaders/technology partners to create the product road map and manage any product changes through the ...
📑 Great vacancy Lead Software Engineer - Dynamics 365 Developer hiring now <meta content=AoeiQ3Ow/BnNjoZ1k2kL0ix9SXzlnjm47YFisfuVAskKVTny0NGo4CEkVQNe1OCi48F77X4EZc6G69wDDJtAlggAAABleyJvcmlnaW4iOiJodHRwczovL3NhbGVzZm9yY2Ut ...
📑 Great vacancy Senior Software Engineer - Dynamics 365 Developer hiring now <meta content=AoeiQ3Ow/BnNjoZ1k2kL0ix9SXzlnjm47YFisfuVAskKVTny0NGo4CEkVQNe1OCi48F77X4EZc6G69wDDJtAlggAAABleyJvcmlnaW4iOiJodHRwczovL3NhbGVzZm9yY2 ...
📑 Our Purpose Mastercard powers economies and empowers people in 200+ countries and territories worldwide. Together with our customers, we’re helping build a sustainable economy where everyone can prosper. We support a wide range of digital payments choices, making transactions secure, simple, ...
📑 At eBay, we're more than a global ecommerce leader — we’re changing the way the world shops and sells. Our platform empowers millions of buyers and sellers in more than 190 markets around the world. We’re committed to pushing boundaries and leaving our mark as we reinvent the future of ecommerce for enthusias ...
📑 At eBay, we're more than a global ecommerce leader — we’re changing the way the world shops and sells. Our platform empowers millions of buyers and sellers in more than 190 markets around the world. We’re committed to pushing boundaries and leaving our mark as we reinvent the future of ecommerce for enthusias ...
📑 Requisition #: 20717Functional Area: Software DevelopmentEmployment Type: Full-TimeWork Options: Remote / Work from Home in India #LI-RemoteWork Hours: 12PM - 9PM IST<div style=padding:10.0px 0.0 ...
📑 Our PurposeMastercard powers economies and empowers people in 200+ countries and territories worldwide. Together with our customers, we’re helping build a sustainable economy where everyone can prosper. We support a wide range of digital payments choices, making transactions secure, simple, s ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,421,545+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Machine Learning Intern | Pollax | Full-time |
| Endpoint Security Operations Engineer | Lenovo | Full-time |
| GES MBSE VE/Propulsion Systems Team... | Satyam Venture Engineering Services | Full-time |
| Software Developer | TAAS Partners | Full-time |
| Senior RAN Engineer | JUARA IT SOLUTIONS | Full-time |
| Frontend Developer | Insight Global | Full-time |
| Frontend Developer | Insight Global | Full-time |
| Associate Recruitment Consultant | Playdawn’s Trusted Game Studios | Full-time |
| Associate Recruitment Consultant | Playdawn’s Trusted Game Studios | Full-time |
| Assistant Architect-Blockchain... | Allianz Technology SE India Branch | fulltime |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!