📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management </ ...
📑 • Extensive Data Engineering background with strong recent IBM DB2 and NoSQL/Cosmos D.B. Skills. • Experience across the Microsoft Azure Data Stack, including Azure Data Lake, Azure Data Factory, Azure Data warehouse. • Strong experience in building pipelines in Azure Data Factory Strong experience wit ...
📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management </ ...
📑 • Extensive Data Engineering background with strong recent IBM DB2 and NoSQL/Cosmos D.B. Skills. • Experience across the Microsoft Azure Data Stack, including Azure Data Lake, Azure Data Factory, Azure Data warehouse. • Strong experience in building pipelines in Azure Data Factory Strong experience wit ...
📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management Ability to wo ...
📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management </ ...
📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM, Solution ManagerProven leadership of 15–20 team members in shiftsExperience in multiple SAP support projectsSolid understanding of ITIL framework, incident & change management<li ...
📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM, Solution ManagerProven leadership of 15–20 team members in shiftsExperience in multiple SAP support projectsSolid understanding of ITIL framework, incident & change managementAbility to work ind ...
📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM , Solution Manager Proven leadership of 15–20 team members in shifts Experience in multiple SAP support projects Solid understanding of ITIL framework, incident & change management Ability to wo ...
📑 Expertise in SAP Basis (ABAP + Java Stack), FRUN, Cloud ALM, Solution ManagerProven leadership of 15–20 team members in shiftsExperience in multiple SAP support projectsSolid understanding of ITIL framework, incident & change managementAbility to work ind ...
📑 Designation - Sr. Software Engineer Location: Bangalore Experience: 7-9 years Job Description: • Looking for ServiceNow Developer, having expert level experience in CMDB / ...
📑 Associate AI Engineer Job Title: Associate AI Engineer Location: Bangalore Department: Technology Experience : 1-4 years (relevant) About Digital Green Digital Green ( is a pioneer global not for profit organizatio ...
📑 Senior Software Engineer, Edge TPU Developer Tools _corporate_fare_ Google _place_ Bengaluru, Karnataka, India **Mid** Experience driving progress, solving problems, and mentoring more junior team members; deeper expertise and applied knowledge within relevant area. **Minimum ...
📑 Staff Software Engineer, Ads _corporate_fare_ Google _place_ Bengaluru, Karnataka, India **Advanced** Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep expertise in domain. **Minimum qualifications:** + Bache ...
📑 We are looking for an Automation and Integration Engineer to join our growing technology team in Mumbai and support a critical application that powers complex supplier validation and questionnaire workflows across our platform ecosystem. We are looking for someone who enjoys solving complex l ...
📑 We are looking for an Automation and Integration Engineer to join our growing technology team in Mumbai and support a critical application that powers complex supplier validation and questionnaire workflows across our platform ecosystem. We are looking for someone who enjoys solving complex l ...
📑 We are looking for an Automation and Integration Engineer to join our growing technology team in Mumbai and support a critical application that powers complex supplier validation and questionnaire workflows across our platform ecosystem. We are looking for someone who enjoys solving complex l ...
📑 We are looking for an Automation and Integration Engineer to join our growing technology team in Mumbai and support a critical application that powers complex supplier validation and questionnaire workflows across our platform ecosystem. We are looking for someone who enjoys solving complex l ...
📑 About Us:Proofpoint is a global leader in human- and agent-centric cybersecurity. We protect how people, data, and AI agents connect across email, cloud, and collaboration tools. Over 80 of the Fortune 100, 10,000 large enterprises, and millions of smaller organizations trust Proofpoint to stop ...
📑 Project Role : Sustainability EngineerProject Role Description : Provide end-to-end engineering services to help companies reduce their resources footprint and achieve their sustainability targets. Develop technical engineering solutions, conduct feasibility studies, carry out investigations ...
📑 Job Title: Senior Backend Engineer Location: Bangalore Experience Level: Senior (8+ years) About the Role We are looking for an exceptional Senior Backend Engineer to join our Bangalore office. This is not a role for someone looking to ex ...
📑 Implementation EngineerDepartment Engineering – Io T & Hardware ExperienceLocation - Hyderabad, IndiaEmployment Type 2–5 Years Full-TimeZest Io T Technologies builds intelligent software for aviation ground operations. Our Io T layer is the foundation of real-time equipment tracking — powering ar ...
📑 Job Title: Senior Backend Engineer Location: Bangalore Experience Level: Senior (8+ years) About the Role We are looking for an exceptional Senior Backend Engineer to join our Bangalore office. This ...
📑 Job Title: Executive – AI Engineering Location: Andheri (Mumbai) Industry: Pharmaceutical Experience Required: 3 years in Gen AI/ML, NLP application development Employment Type: Full-time About the Role We are looking for a highly skilled AI Engineer – GenAI & Applied ML to independently design, develop, and dep ...
📑 Architect - Data Governance Chennai, Bangalore, Hyderabad Who we are Tiger Analytics is a global leader in Data, AI, and Analytics, helping Fortune 500 companies solve their most complex business challenges. We offer full-stack AI and analytics services & solutions to empower businesses to achieve real outcomes ...
📑 Job Title: Senior Backend Engineer Location: Bangalore Experience Level: Senior (8+ years) About the Role We are looking for an exceptional Senior Backend Engineer to join our Bangalore office. This ...
📑 Project Role : Sustainability EngineerProject Role Description : Provide end-to-end engineering services to help companies reduce their resources footprint and achieve their sustainability targets. Develop technical engineering solutions, conduct feasibility studies, carry out investigations ...
📑 Job Title: Senior Backend EngineerLocation: Bangalore Experience Level: Senior (8+ years)About the RoleWe are looking for an exceptional Senior Backend Engineer to join our Bangalore office. This is not ...
📑 Job Title: Senior Backend EngineerLocation: Bangalore Experience Level: Senior (8+ years)About the RoleWe are looking for an exceptional Senior Backend Engineer to join our Bangalore office. This is not a role for someone looking to execute ti ...
📑 Implementation EngineerDepartment Engineering – IoT & Hardware ExperienceLocation - Hyderabad, IndiaEmployment Type 2–5 Years Full-TimeZestIoT Technologies builds intelligent software for aviation ground operations. Our IoT layer is the foundation of real-time equipment tracking — pow ...
📑 Job Title: Senior Backend Engineer Location: Bangalore Experience Level: Senior (8+ years) About the Role We are looking for an exceptional Senior Backend Engineer to join our Bangalore office. This is not a role for someone looking to ex ...
📑 Implementation EngineerDepartment Engineering – Io T & Hardware ExperienceLocation - Hyderabad, IndiaEmployment Type 2–5 Years Full-TimeZest Io T Technologies builds intelligent software for aviation ground operations. Our Io T layer is the foundation of real-time equipment tracking — powering ar ...
📑 Job Title: Senior Backend EngineerLocation: Bangalore Experience Level: Senior (8+ years)About the RoleWe are looking for an exceptional Senior Backend Engineer to join our Bangalore office. This is not ...
📑 Implementation EngineerDepartment Engineering – IoT & Hardware ExperienceLocation - Hyderabad, IndiaEmployment Type 2–5 Years Full-TimeZestIoT Technologies builds intelligent software for aviation ground operations. Our IoT layer is the foundation of real-time equipment tracking — pow ...
📑 Job Title: Senior Backend Engineer Location: Bangalore Experience Level: Senior (8+ years) About the Role We are looking for an exceptional Senior Backend Engineer to join our Bangalore office. This ...
📑 Job Title: Senior Backend Engineer Location: Bangalore Experience Level: Senior (8+ years) About the Role We are looking for an exceptional Senior Backend Engineer to join our Bangalore office. This is not a role for someone looking to ex ...
📑 Job Title: Executive – AI Engineering Location: Andheri (Mumbai) Industry: Pharmaceutical Experience Required: 3 years in Gen AI/ML, NLP application development Employment Type: Full-time About the Role We are looking for a highly skilled AI Engineer – GenAI & Applied ML to independently design, develop, and dep ...
📑 Project Role : Sustainability EngineerProject Role Description : Provide end-to-end engineering services to help companies reduce their resources footprint and achieve their sustainability targets. Develop technical engineering solutions, conduct feasibility studies, carry out investigations, ...
📑 Job Title: Senior Backend EngineerLocation: Bangalore Experience Level: Senior (8+ years)About the RoleWe are looking for an exceptional Senior Backend Engineer to join our Bangalore office. This is not a role for someone looking to execute ti ...
📑 Project Role : Sustainability EngineerProject Role Description : Provide end-to-end engineering services to help companies reduce their resources footprint and achieve their sustainability targets. Develop technical engineering solutions, conduct feasibility studies, carry out investigations, ...
📑 Overview Agnik is a global connected car technology company ( with its products operating in 200+ countries and headquartered in USA with major consumer brands like Vyncs ( and several B2B products. Agnik is looking for intelligent, ethical, hard-working profess ...
📑 Description P&G was founded over 180 years ago as a simple soap and candle company. Today, we're the world’s largest consumer goods company and home to iconic, trusted brands that make life a little bit easier in small but meaningful ways. We've spanned three centuries thanks to three ...
📑 Join ABC Fitness and become part of a culture that’s as ambitious as it is authentic. Let’s transform the future of fitness—together! Our Values Best Life We believe great work begins with great people. That’s why our culture is built on respect, trust, and belonging. We create an ...
📑 We help the world run better At SAP, we keep it simple: you bring your best to us, and we'll bring out the best in you. We're builders touching over 20 industries and 80% of global commerce, and we need your unique talents to help shape what's next. The work is challenging – but it matt ...
📑 Company Description NEC Software Solutions (India) On 1st July 2021, Rave Technologies became NEC Software Solutions India. This change brought us under the global NEC Corporation brand. We are proud to be part of an organisation with 122 years of experience in evolution with ...
📑 Job Description .css-ylb{color:var(--chakra-colors-black-);}.css-l0deym h1{margin:0;padding:0;font-size:26px;}.css-l0deym h2{margin:0;padding:0;font-size:20px;}.css-l0deym h3{margin:0;padding:0;font-size:15px;}.css-l0deym h4{margin:0;padding:0;font-size:13px;}.css-l0deym ul{list-styl ...
📑 As part of the AWS Applied AI Solutions organization, we have a vision to provide business applications, leveraging Amazon’s unique experience and expertise, that are used by millions of companies worldwide to manage day-to-day operations. We will accomplish this by accelerating our customers’ businesses through ...
📑 Job Description WHAT YOU’LL DO We are looking for talented Senior Software Engineers with strong experience in .NET Core, Azure cloud services, and to build modern, scalable, and high-performance enterprise applications. You will work on cloud-native solutions, ...
📑 About Tsavorite Scalable Intelligence Inc. Tsavorite Scalable Intelligence is developing the semiconductor industry's first Omni Processing Unit TM (OPU)—a unified platform that brings together CPU, GPU, Memory and Connectivity in a single device, engineered for the next wave of Agentic AI workloads. ...
📑 Applications should be submitted to: HzJOB DESCRIPTIONHead of Growth Marketing — Authentica Reports To: Chief Executive Officer (CEO) Location: Pune (Onsite, Full-Time) Team: 3 direct reports (Digital Marketing Manager, Visual Storyteller & Videographer, Social Media Executive) Effective Date: FY (May ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,421,547+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| SAP Basis Consultant | YASH Technologies | Full-time |
| Azure Data Engineer with IBM DB2 | Anicalls (Pty) Ltd | Full-time |
| SAP Basis Consultant | YASH Technologies | Full-time |
| Azure Data Engineer with IBM DB2 sp... | Anicalls (Pty) Ltd | Full-time |
| SAP Basis Consultant | YASH Technologies | Full-time |
| SAP Basis Consultant | YASH Technologies | Full-time |
| SAP Basis Consultant | YASH Technologies | Full-time |
| SAP Basis Consultant | YASH Technologies | Full-time |
| SAP Basis Consultant | YASH Technologies | Full-time |
| SAP Basis Consultant | YASH Technologies | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!