📑 Amazon Time & Pay Innovation (T&PA) organisation is looking for Software Development Engineers who enjoy working in a green field environment building large-scale intelligent products and services that offer a consumer grade user experience using a service oriented architecture, based on native AWS components.<b ...
📑 Have you ever wanted to be part of a team that builds highly efficient operating system for E-reader? Amazon's E-reader team owns full stack device platform, Productivity offering built on GenAI, LLM, handwriting recognition etc and low-level components that make the device energy efficient with weeks of battery ...
📑 Position Description: Position DescriptionCompany Profile:Founded in , CGI is among the largest independent IT and business consulting services firms in the world. With 94, consultants and professionals across the globe, CGI delivers an end-to-end portfolio of capabilities, f ...
📑 IND Staff Engineer, Infrastructure - GCC036We’re determined to make a difference and are proud to be an insurance company that goes well beyond coverages and policies. Working here means having every opportunity to achieve your goals – and to help others accomplish theirs, too. Join our team as we help shape ...
📑 Job Title: Java FSD Experience: 6-9yrs / 3-6yrsLocation: Bangalore /GurgaonEmployment Type: Full-Time/hybrid Key skills- Core Java ,Microservices ,springbbot, Angular, SQL Job R ...
📑 Retention & CRM SpecialistWho are WeWe are Go Stops - Go STOPS threw open its doors in 2014 based on the simple belief that travel changes lives. When you go MORE, you be MORE: be it at the start of the journey when you’re braving your first solo train ride; in the middle, when you’ve found a kindred spi ...
📑 ---**About ALIV**ALIV is a doctor-led regenerative wellness clinic offering targeted IV therapies, PRP/PRFM, peptides, and autologous cell-based therapies. We work at the intersection of prevention, performance, and longevity — with a focus on ethical care and measurable outcomes. We're expanding across ...
📑 Company Vision :Stock Gro is an investment advisory and knowledge platform that connects users with SEBI-registered experts to explore advanced investment strategies. It empowers users to master trading and investing through insightful market analysis, expert recommendations, and AI-powered research tools. W ...
📑 Senior Salesforce Pre-Sales Solution Engineer Location: Hyderabad | Bengaluru | Chennai | Mumbai | Pune Experience: 6 years total, minimum 1 year in Pre-Sales Solution Engineering Employment Type: Full-Time About Wilco Source Wilco Source is a Salesforce partner exclusively focused on Healthcare & Life Sciences ...
📑 The Applications Development Senior Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute to app ...
📑 About Position: We are seeking a Gen AI Architect to lead the design and implementation of enterprise-scale Generative AI and agentic AI solutions on the Microsoft Azure platform. This role focuses on defining end-to-end AI architecture, enabling intelligent agent ecosystems, and driving scalable, secure, and re ...
📑 Company Vision :Stock Gro is an investment advisory and knowledge platform that connects users with SEBI-registered experts to explore advanced investment strategies. It empowers users to master trading and investing through insightful market analysis, expert recommendations, and AI-powered research tools. W ...
📑 This job is with HP, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Android Security ExpertDescription -Role:Android Security Specialist with deep expertise in platform security, app ...
📑 Amazon Time & Pay Innovation (T&PA) organisation is looking for Software Development Engineers who enjoy working in a green field environment building large-scale intelligent products and services that offer a consumer grade user experience using a service oriented architecture, based on native AWS components.<b ...
📑 SummaryCompany: Skalegrow Private LimitedPosition: Graphic DesignerLocation: BengaluruJob Type: Full-timeOverviewSkalegrow is a full-stack B2B marketing agency that helps companies in the IT, tech, SaaS, robotics, and embedded systems industries grow with marketing.This ro ...
📑 About FotelloFotello is the AI operating system for real estate media. Booking, editing, delivery, payments,property websites, agent portals, every workflow a creator depends on runs on us.Small team out of IIT, UBC, AWS, and Angi, based in Vancouver and Gurgaon. Bootstrapped.Profitable. The default platform in ...
📑 SummaryCompany: Skalegrow Private LimitedPosition: Graphic DesignerLocation: BengaluruJob Type: Full-timeOverviewSkalegrow is a full-stack B2B marketing agency that helps companies in the IT, tech, SaaS, robotics, and embedded systems industries grow with marketing.This ro ...
📑 About FotelloFotello is the AI operating system for real estate media. Booking, editing, delivery, payments,property websites, agent portals, every workflow a creator depends on runs on us.Small team out of IIT, UBC, AWS, and Angi, based in Vancouver and Gurgaon. Bootstrapped.Profitable. The default platform in ...
📑 Company Vision :StockGro is an investment advisory and knowledge platform that connects users with SEBI-registered experts to explore advanced investment strategies. It empowers users to master trading and investing through insightful market analysis, expert recommendations, and AI-powered research too ...
📑 Company Vision :StockGro is an investment advisory and knowledge platform that connects users with SEBI-registered experts to explore advanced investment strategies. It empowers users to master trading and investing through insightful market analysis, expert recommendations, and AI-powered research too ...
📑 This job is with HP, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Android Security ExpertDescription -Role:Android Security Specialist with deep expertise in platform security, app ...
📑 Position Description: Position DescriptionCompany Profile:Founded in , CGI is among the largest independent IT and business consulting services firms in the world. With 94, consultants and professionals across the globe, CGI delivers an end-to-end portfolio of capabilities, from ...
📑 Job Overview:We seek several Full Stack MS.NET Core Engineers with a strong background in software engineering to join our dynamic team. The ideal candidate will have extensive experience in.NET development specially MS.NET ...
📑 Have you ever wanted to be part of a team that builds highly efficient operating system for E-reader? Amazon's E-reader team owns full stack device platform, Productivity offering built on GenAI, LLM, handwriting recognition etc and low-level components that make the device energy efficient with weeks of battery ...
📑 The Applications Development Senior Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute to app ...
📑 IAM Operations Engineer_386Job Objectives: Develop and implement DevOps practices to transform the IAM project.Engage in all phases of DevOps including planning, building, testing, deploying, and monitoring.Coll ...
📑 The Applications Development Senior Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute to app ...
📑 IND Staff Engineer, Infrastructure - GCC036We’re determined to make a difference and are proud to be an insurance company that goes well beyond coverages and policies. Working here means having every opportunity to achieve your goals – and to help others accomplish theirs, too. Join our team as we help shape ...
📑 The Applications Development Senior Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute to app ...
📑 We are looking for an Automation and Integration Engineer to join our growing technology team in Mumbai and support a critical application that powers complex supplier validation and questionnaire workflows across our platform ecosystem. We are looking for someone who enjoys solving complex l ...
📑 About FireboltFirebolt is an Open Source Postgres-compliant agentic analytical database built for realtime datalake workloads. It is cloud-native and built to scale out, running anywhere from a single binary on a laptop to a cluster of hundreds of nodes.The timing matters. Agent ...
📑 We are looking for an Automation and Integration Engineer to join our growing technology team in Mumbai and support a critical application that powers complex supplier validation and questionnaire workflows across our platform ecosystem. We are looking for someone who enjoys solving complex l ...
📑 About Ferguson: Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively solve problem ...
📑 We are looking for an Automation and Integration Engineer to join our growing technology team in Mumbai and support a critical application that powers complex supplier validation and questionnaire workflows across our platform ecosystem. We are looking for someone who enjoys solving complex l ...
📑 We are looking for an Automation and Integration Engineer to join our growing technology team in Mumbai and support a critical application that powers complex supplier validation and questionnaire workflows across our platform ecosystem. We are looking for someone who enjoys solving complex l ...
📑 About Us:Proofpoint is a global leader in human- and agent-centric cybersecurity. We protect how people, data, and AI agents connect across email, cloud, and collaboration tools. Over 80 of the Fortune 100, 10,000 large enterprises, and millions of smaller organizations trust Proofpoint to stop ...
📑 3Pillar is an AI transformation partner on a mission to help enterprises build the AI-native products and intelligent agents that will define the next era of business. With teams across North America, Europe, Latin America, and Asia, we work with the most ambitious companies in financial services, healthcare, ...
📑 Associate AI Engineer Job Title: Associate AI Engineer Location: Bangalore Department: Technology Experience : 1-4 years (relevant) About Digital Green Digital Green ( is a pioneer global not for profit organizatio ...
📑 Staff Software Engineer, Ads _corporate_fare_ Google _place_ Bengaluru, Karnataka, India **Advanced** Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep expertise in domain. **Minimum qualifications:** + Bache ...
📑 **Overview** **About Business Unit:** The Product team forms the crux of our powerful platforms and helps connect millions of customers worldwide with the brands that matter most to them. This team of innovative problem solvers develops and builds products that position Epsilon as a differentia ...
📑 Job Title: BIW Dimensional Engineer Experience: 2 - 4 Years Qualification: B.E/B.Tech (Mechanical Engineer) No. of Positions: 1 Job Location: Chennai Job Description: ...
📑 How would you like to impact millions of customers around the world using Amazon Search? This team measures the spectrum of Search experiences on Amazon and helps root cause and deep dive escalations from customers and leadership point of view.From highlighting pain points to surfacing abuse across 21 ...
📑 Job Description: ITOps Consultant – Monitoring & ObservabilityOverview:We are seeking an experienced ITOps Consultant – Monitoring & Observability to design,implement, and operate enterprise-grade monitoring solutions. This role focuses on ensuring high availability, performance, and reliability of I ...
📑 10+ years experience in the ecosystem of Cloud NativeComputing Foundation (CNCF) • 10+ years experience in cloud platform engineering or SRE roles • Expert-level Terraform — modular architecture, Terraform Cloud, statemanagement, provider development • Deep Azure knowledge — AKS, Key Va ...
📑 Job Description: ITOps Consultant – Monitoring & ObservabilityOverview:We are seeking an experienced ITOps Consultant – Monitoring & Observability to design,implement, and operate enterprise-grade monitoring solutions. This role focuses on ensuring high availability, performance, and reli ...
📑 Job Description: ITOps Consultant – Monitoring & ObservabilityOverview:We are seeking an experienced ITOps Consultant – Monitoring & Observability to design,implement, and operate enterprise-grade monitoring solutions. This role focuses on ensuring high availability, performance, and reliability of I ...
📑 Job Description: ITOps Consultant – Monitoring & ObservabilityOverview:We are seeking an experienced ITOps Consultant – Monitoring & Observability to design,implement, and operate enterprise-grade monitoring solutions. This role focuses on ensuring high availability, performance, and reli ...
📑 How would you like to impact millions of customers around the world using Amazon Search? This team measures the spectrum of Search experiences on Amazon and helps root cause and deep dive escalations from customers and leadership point of view.From highlighting pain points to surfacing abuse across 21 ...
📑 Senior AI/Data Analytics EngineerExperience: 5+ YearsLocation: On-site - BangaloreJob SummarySeeking an experienced Senior AI/Data Analytics Engineer to design, develop, and deploy advanced AI-driven solutions that transform traditional reporting into pr ...
📑 Position: Implementation Lead Reporting to – Chief Delivery Officer (CDO) Exp: 7+ Years Company: Veefin Solutions Pvt. Ltd. Location – Mumbai (India & Oversea Travel as per need for short period ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,487,166+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Software Dev Engineer, Amazon Time &... | ADCI HYD 13 SEZ | Full-time |
| Software Development Engineer,... | ADCI - Karnataka | Full-time |
| Senior Software Engineer-APIGEE | CGI | Full-time |
| IND - Staff Engineer, Infrastructure | The Hartford | Full-time |
| Statusneo- Java FSD(Snr/ Junior) | Nexthire | Full-time |
| Retention specialist | GoSTOPS | Full-time |
| Medical doctor | ALIV - Regenerative Wellness | Full-time |
| Brand marketeer | StockGro | Full-time |
| Senior Salesforce Pre-Sales Solution Engineer | Wilco Source | Full-time |
| Java Fullstack Developer- Assistant... | 12542 Citicorp Services India Private Limited | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!