1,487,266+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

Data Architect

📑 Data Architect Databricks Data Engineering & Pipelines | Mid-Level | Full-Time Experience 5 8 Years Level Mid-Level Employment Type Full-Time Location Pune - Hybrid Primary Stack Databricks, Apache Spark, Delta Lake, SQL Domain Data Engineering & Pipelines About the Role We are looking for a hands-on Data Arch ...

Digital Marketing Executive Locations: (1) Columbia, MD, USA, (2) Berkeley, CA, USA. (3) Kolkata, India, (4) Remote (partial/full).

📑 Responsibilities As an employee of Agnik, the primary focus of the Digital Marketing Executive would be to monitor and grow the search traffic for its market leading connected car products using digital marketing techniques for search engines, social ...

IT HELP DESK TECHNICIAN | 12 month contract with opportunity for Full time | Global company based in South East Melbourne

📑 IT HELP DESK TECHNICIAN | 12 month contract with opportunity for Full-time | Global company based in South East Melbourne A global company based in South East Melbourne 12 month full-time contract with oppo ...

IT HELP DESK TECHNICIAN | 12 month contract with opportunity for Full time | Global company based in South East Melbourne

📑 IT HELP DESK TECHNICIAN | 12 month contract with opportunity for Full-time | Global company based in South East Melbourne A global company based in South East Melbourne12 month full-time contract with opportun ...

Digital Marketing Executive Locations: (1) Columbia, MD, USA, (2) Berkeley, CA, USA. (3) Kolkata, India, (4) Remote (partial/full).

📑 Responsibilities As an employee of Agnik, the primary focus of the Digital Marketing Executive would be to monitor and grow the search traffic for its market leading connected car products using digital marketing techniques for search engines, s ...

Yocto

📑 Required Skills Core Look for a experience between 4 to 6 Years Strong experience with Yocto Project (meta layers, recipes, bbappend, bitbake debugging). Experience working with NXP i.MX6 platform. Linux kernel ...

Director Supply Chain Engineering [T500 26636]

📑 About Ferguson: Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively sol ...

Director Supply Chain Engineering [T500 26636]

📑 About Ferguson: Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively sol ...

Artificial Intelligence & Machine Learning Engineer (Multi Agent Systems) Assistant Vice President

📑 Role Summary: We are seeking a Senior AI Engineer with deep expertise in multi-agent AI systems (agentic architectures) to design and deliver next-generation intelligent solutions at enterprise scale. This role requires a strong foundation in traditional software engineering com ...

MarTech Engineer (all genders)

📑 HRS AS A COMPANY HRS, a pioneer in business travel, aims to elevate every stay through innovative technology. With over years of experience, their digital platform, driven by ProcureTech, TravelTech, and FinTech, transforms how companies and travelers Stay, Work, and Pay. ...

Sr. Lead Software Engineer

📑 Overview Voyager (94001), India, Bangalore, KarnātakaSr. Lead Software EngineerDo you love building and pioneering in the technology space? Do you enjoy solving complex business problems in a fast-paced, collaborative, inclusive, and iterative delivery environment? At Capital O ...

Director Supply Chain Engineering [T500 26636]

📑 About Ferguson: Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively solve problem ...

Director Supply Chain Engineering [T500 26636]

📑 About Ferguson: Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively solve problem ...

Sustaining Engineer

📑 About Us: Proofpoint is a global leader in human- and agent-centric cybersecurity. We protect how people, data, and AI agents connect across email, cloud, and collaboration tools. Over 80 of the Fortune 100, 10,000 large enterprises, and millions of smaller organizations trust Proofpoint to sto ...

Senior Fullstack Engineer (react/.net)

📑 3PILLAR GLOBAL Company 3Pillar is an AI transformation partner on a mission to help enterprises build the AI-native products and intelligent agents that will define the next era of business. With teams across North America, Europe, Latin America, and Asia, we work with the most ambitious companies in fi ...

Director Supply Chain Engineering [T500 26636]

📑 About Ferguson: Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively sol ...

Supply Chain Engineering Director

📑 About Ferguson:Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively solve ...

Technical Account Executive

📑 About FireboltFirebolt is an Open Source Postgres-compliant agentic analytical database built for realtime datalake workloads. It is cloud-native and built to scale out, running anywhere from a single binary on a laptop to a cluster of hundreds of nodes.The timing matters. Agentic AI is p ...

Technical Account Executive

📑 About FireboltFirebolt is an Open Source Postgres-compliant agentic analytical database built for realtime datalake workloads. It is cloud-native and built to scale out, running anywhere from a single binary on a laptop to a cluster of hundreds of nodes.The timing matters. Agentic AI is p ...

Director Supply Chain Engineering [T500 26636]

📑 About Ferguson: Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively solve problem ...

Head of Supply Chain Technology

📑 About Ferguson:Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively solve ...

Director Supply Chain Engineering [T500 26636]

📑 About Ferguson:Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively solve ...

Director Supply Chain Engineering [T500 26636]

📑 About Ferguson: Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively solve problem ...

Director Supply Chain Engineering T500 26636

📑 About Ferguson:Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively solve ...

Director Supply Chain Engineering [T500 26636]

📑 About Ferguson: Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively solve problem ...

Lead Supply Chain Solutions Architect

📑 About Ferguson:Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively solve ...

Director Supply Chain Engineering [T500 26636]

📑 About Ferguson:Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively solve ...

Director Supply Chain Engineering [T500 26636]

📑 About Ferguson:Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively solve problems, ...

Director Supply Chain Engineering [T500 26636]

📑 About Ferguson: Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively sol ...

Director Supply Chain Engineering [T500 26636]

📑 About Ferguson: Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively solve problem ...

Director Supply Chain Engineering [T500 26636]

📑 About Ferguson:Since 1953, Ferguson has been a source of quality supplies for a variety of industries. Together We Build Better infrastructure, better homes and better businesses. We exist to make our customers’ complex projects simple, successful, and sustainable. We proactively solve problems, ...

Artificial Intelligence & Machine Learning Engineer (Multi Agent Systems) Assistant Vice President

📑 Role Summary:We are seeking a Senior AI Engineer with deep expertise in multi-agent AI systems (agentic architectures) to design and deliver next-generation intelligent solutions at enterprise scale. This role requires a strong foundation in traditional software engineering combine ...

Sr. Lead Software Engineer

📑 Overview Voyager (94001), India, Bangalore, KarnātakaSr. Lead Software EngineerDo you love building and pioneering in the technology space? Do you enjoy solving complex business problems in a fast-paced, collaborative, inclusive, and iterative delivery environment? At Capital One, ...

MarTech Engineer (all genders)

📑 HRS AS A COMPANY HRS, a pioneer in business travel, aims to elevate every stay through innovative technology. With over years of experience, their digital platform, driven by ProcureTech, TravelTech, and FinTech, transforms how companies and travelers Stay, Work, and Pay.< ...

Sales Operations Specialist

📑 - Title: Product Coordination Analyst - Department: IT - Work Type: PAN INDIA - Shift Timing : US Shift Job Description: Minimum Requirements: ● Demonstrate an interest in technology sales ● 3 years of experience in a Sales/Revenue Operations or related field, with a focus on sales tech stack, project/ticket del ...

Senior Golang Developer

📑 At Qube Cinema, technology and innovation are at our core. Our purpose is to bring to life every story to engage, entertain and enlighten the world. As a company with a passion for cinema, we are committed to creating a seamless world of digital cinema with products that are innovative, powerf ...

Shopify Developer

📑 Company Description Cumin Co. is a cookware brand dedicated to creating mindful, well-designed products that support modern, health-conscious living. The company focuses on toxin-free, simple, and durable kitchenware that aligns with a minimalist, intentional lifestyle. Every product blends aesthetics wi ...

Databricks Machine Learning Engineer

📑 Full Stack DE Expert Location: Remote Experience: 8+ Years Company OverviewCodvo is a global empathy-led technology services company where software engineering excellence and human-centered innovation come ...

Digital Storefront Developer (Shopify)

📑 Company Description Cumin Co. is a cookware brand dedicated to creating mindful, well-designed products that support modern, health-conscious living. The company focuses on toxin-free, simple, and durable kitchenware that aligns with a minimalist, intentional lifestyle. Every product blends aest ...

Search engine optimization specialist

📑 This isn't a keyword tricks and hacks role. We're hiring someone who can turn organic search into a predictable revenue engine — a marketer who operates where AI, data, and growth strategy meet. What You'll Own Lead SEO/AEO strategy end-to-end Own the full search strategy ...

Lead Electrical Engineer Substation

📑 Company DescriptionROSS Controls, headquartered in Ferndale, Michigan, is an international leader in manufacturing pneumatic valves, control systems, and safety products for the fluid power industry. Established in 1921, ROSS has maintained a prominent position in pneumatic valve technology and continues to offe ...

LLM and MLOps Specialist

📑 Role : SDE 2Experience: 2+ YearsLocation: Mumbai- Andheri East (On-site)Introduction-$11 trillion of money flows every year between companies in India. It typically takes avg. 70 days for a business to get paid, an ...

Senior Software Engineer – Telecommunications Network Management Systems (NMS)

📑 About Polaris Wireless Polaris Wireless is a Silicon Valley-based innovator of software-driven wireless Location Intelligence solutions, founded in 2001. The company locates mobile devices across all carrier networks and air interfaces (2G–5G) using patented RF pattern-matching technology (WLS™ ...

Shopify Developer

📑 Company Description Cumin Co. is a cookware brand dedicated to creating mindful, well-designed products that support modern, health-conscious living. The company focuses on toxin-free, simple, and durable kitchenware that aligns with a minimalist, intentional lifestyle. Every product blends aesthetics wit ...

Shopify Developer

📑 Company Description Cumin Co. is a cookware brand dedicated to creating mindful, well-designed products that support modern, health-conscious living. The company focuses on toxin-free, simple, and durable kitchenware that aligns with a minimalist, intentional lifestyle. Every product blends aesthetics wi ...

Shopify Developer

📑 Company Description Cumin Co. is a cookware brand dedicated to creating mindful, well-designed products that support modern, health-conscious living. The company focuses on toxin-free, simple, and durable kitchenware that aligns with a minimalist, intentional lifestyle. Every product blends aest ...

Msme Solar Sales State Head

📑 Company: Aerem Solutions Locations: Hyderabad (AP & Telangana) | Surat / Ahmedabad (Gujarat) | Lucknow (Uttar Pradesh) Reporting to: Business Head About Aerem Solutions Aerem is on a mission to democratize solar energy for India’s MSME sector. We are providing a full-stack solution that includes high-quality EPC ...

Artificial Intelligence Engineer

📑 Role : SDE 2 Experience: 2+ Years Location: Mumbai- Andheri East (On-site) Introduction- $11 trillion of money flows every year between companies in India. It typically takes avg. 70 days for a business to get paid, and it’s increasing 5% every year, ...

Shopify Developer

📑 Company Description Cumin Co. is a cookware brand dedicated to creating mindful, well-designed products that support modern, health-conscious living. The company focuses on toxin-free, simple, and durable kitchenware that aligns with a minimalist, intentional lifestyle. Every product blends aesthetics wi ...

Data Platform and MLOps Engineer

📑 Full Stack DE Expert Location: Remote Experience: 8+ Years Company OverviewCodvo is a global empathy-led technology services company where software engineering excellence and human-centered innovation come ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,487,266+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
Data Architect nCircle Tech Pvt. Ltd. Full-time
Digital Marketing Executive... Agnik Full-time
IT HELP DESK TECHNICIAN | 12 month... Good People HR Pty Ltd Full-time
IT HELP DESK TECHNICIAN | 12 month... Good People HR Pty Ltd Full time
Digital Marketing Executive... Agnik Full-time
Yocto ObjectWin Technology India Pvt. Ltd Full-time
Director Supply Chain Engineering... Ferguson India Full-time
Director Supply Chain Engineering... Ferguson India Full-time
Artificial Intelligence & Machine... State Street Full-time
MarTech Engineer (all genders) HRS Group Full-time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!