📑 Location: Remote Experience: 3+ Years Salary: Competitive Reports to: Founder & Director Role Overview: The Digital Marketing & Ecommerce Specialist will be responsible for ...
📑 Location: Remote Experience: 3+ Years Salary: Competitive Reports to: Founder & Director Role Overview: The Digital Marketing & Ecommerce Specialist will be responsible for ...
📑 Location: Remote Experience: 3+ Years Salary: Competitive Reports to: Founder & Director Role Overview: The Digital Marketing & Ecommerce Specialist will be responsible for ...
📑 Senior AI Architect Experience: 9–10 years (with 3+ years architecting and shipping production AI systems) Location: Chennai, India Role Summary: You will own the technical architecture o ...
📑 Location: Remote Experience: 3+ Years Salary: Competitive Reports to: Founder & Director Role Overview: The Digital Marketing & Ecommerce Specialist will be responsible for ...
📑 Location: Remote Experience: 3+ Years Salary: Competitive Reports to: Founder & Director Role Overview: The Digital Marketing & Ecommerce Specialist will be responsible for ...
📑 Job Title: Email Domain, Identity & Virtualization SME Job Grade (refer to JE) Senior Manager -2,G9B Function: Information Technology Sub-function: Infra IT Manager’s Job Label: AD/IDAM & Email Lea ...
📑 Role Summary We are seeking an Enterprise Data Modeler / Data Architect to design, govern, and evolve enterprise-wide data models, master data, and reference data across a complex transactional and analytical landscape. You will be responsible for defining canonical, transac ...
📑 Company Description Metro Global Solution Center (MGSC) is internal solution partner for METRO, a € Billion international wholesaler with operations in 32 countries through 625 stores & a team of 85,000 people globally. Metro operates in a further 10 countries with its Food Service Dist ...
📑 Role Summary Sophos Firewall is the flagship product of Sophos, operating in the network security domain to safeguard customer network traffic when deployed in router or switch mode. It processes traffic across all layers, from L2 to L7. As a mature yet continuously evolving product ada ...
📑 Schneider Electric SE is a French multinational company that specializes in digital automation and energy management. Schneider Electric is a publicly traded Fortune Global 500 company, the company posted revenues of €34.2 billion. It addresses homes, buildings, data centres, infrastructure, and industries, ...
📑 Job Title : WAF Security Engineer / WAF Administrator / WAF DevSecOps Engineer (AKAMAI) Location City : PAN India Experience Required : 6+ Years Salary Range: As per norms Work Mode: Hybrid Position Type: Permanent No ...
📑 Job Title : WAF Security Engineer / WAF Administrator / WAF DevSecOps Engineer (AKAMAI) Location City : PAN India Experience Required : 6+ Years Salary Range: As per norms Work Mode: Hybrid Position Type: Permanent No ...
📑 AI Product Manager 8-12yrs Bangalore Role: AI Product Manager (or Senior Product Manager – AI/Agent Products) Context: Agentic AI Deep Research analytics product About the Role We are looking for an ...
📑 AI Product Manager 8-12yrs Bangalore Role: AI Product Manager (or Senior Product Manager – AI/Agent Products) Context: Agentic AI Deep Research analytics product About the Role We are looking for an ...
📑 Date Posted: Country: IndiaLocation: IN-KA-BENGALURU-NORTHGATE ~ Sy No 2/2 Venkatala Village ~ SY NO 2/2 VENKATALA VILLAGE, Yelahanka HobliPosition Role Type: HybridAt RTX, the world largest aerospace and defense company, 185,000 great minds are uni ...
📑 About Us: Proofpoint is a global leader in human- and agent-centric cybersecurity. We protect how people, data, and AI agents connect across email, cloud, and collaboration tools. Over 80 of the Fortune 100, 10,000 large enterprises, and millions of smaller organizations trust Proofpoint to sto ...
📑 Job Objective:CDM Smith is hiring a Senior Enterprise GIS System Specialist for the Digital Engineering Solutions – Geospatial Technology group. The role focuses on enterprise level GIS system architecture, administration, optimization, and integration, supporting business and engineering workflows thr ...
📑 Senior AI Architect Experience: 9–10 years (with 3+ years architecting and shipping production AI systems) Location: Chennai, India Role Summary: You will own the technical architecture of our enterprise AI platform. The core o ...
📑 Location: Remote Experience: 3+ Years Salary: Competitive Reports to: Founder & Director Role Overview: The Digital Marketing & Ecommerce Specialist will be responsible for ...
📑 Location: Remote Experience: 3+ Years Salary: Competitive Reports to: Founder & Director Role Overview: The Digital Marketing & Ecommerce Specialist will be responsible for ...
📑 Location: Remote Experience: 3+ Years Salary: Competitive Reports to: Founder & Director Role Overview: The Digital Marketing & Ecommerce Specialist will be responsible for ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 As a Senior ML Scientist at Wayfair, you’ll shape the future of how millions of customers are engaged through intelligent, timely, and personalized communication powered by scalable AI systems. Who We Ar eWayfair is moving the world so that anyo ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Product Manager 8-12yrs Bangalore Role: AI Product Manager (or Senior Product Manager – AI/Agent Products) Context: Agentic AI Deep Research analytics product < ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
📑 AI Agent Engineer (Manufacturing AI — LangChain / LangGraph / RAG) Role Overview We are seeking an AI Agent Enginee r to design and ship production agentic AI systems for manufacturing clients. You will act as the builder ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 777,592+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Digital Marketing & Ecommerce Specialist | Cave Digital Australia | Full-time |
| Digital Marketing & Ecommerce Specialist | Cave Digital Australia | Full-time |
| Digital Marketing & Ecommerce Specialist | Cave Digital Australia | Full-time |
| Sr. AI Architect | STANCO Solutions Pvt Ltd | Full-time |
| Digital Marketing & Ecommerce Specialist | Cave Digital Australia | Full-time |
| Digital Marketing & Ecommerce Specialist | Cave Digital Australia | Full-time |
| Senior Manager - 2(Email Domain,... | SUN PHARMA | Full-time |
| Associate Principal Engineer (India Office) | Wesco | Full-time |
| SAP Basis & Security Engineer | METRO LOGISTICS | Full-time |
| Senior Software Engineer (C/C++ and... | Sophos | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!