1,069,313+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

Data Engineer

📑 We at Value momentum looking for Data Engineer/ Lead Data Bricks Data Engineer Looking for only Immediate joiners Role: Data Engineer/Lead Data Bricks Data Engineer Experience: 3 –12 Years Employment Type: Perm ...

Data engineer

📑 We are looking for a Data Engineer (specialized in Databricks) with 3-6 years of experience who can go beyond building pipelines — someone who translates analytics logic into reusable, governed data products. The role is for a Healthcare consulting MNC, so pharma domain experience will be a huge plus ...

Automation & control engineer

📑 Automation & Control EngineerRole missionOwn the motion intelligence layer — the kinematics, dynamics, and control code that turn perception into safe, precise physical action. This is the role closest to the hardware and the role on which deployment reliability ultimately rests.Key responsibilities< ...

Sr. data scientist with snowflake experience

📑 Position: Senior Data ScientistWork Location: HyderabadWork Mode: Mon-Fri (Work from Office)Primary Roles & Responsibilities• Design, develop, and deploy AI/ML products and services based on the customer needs.• Design data pipelines• Continually develops capability both against current d ...

Manager Business Intelligence and Insights Group

📑 Job Summary: Define the vision and roadmap for business intelligence team and champion data culture within Axis Max Life. Lead and enable transformation to embrace automation and providing concise & real-time insights. Responsible for delivery of accurate and timely reports / dashboards. Coach and mentor the tea ...

Back end developer (sde 2) golang

📑 Responsibilities: Successfully and independently deliver large-size projects, including scoping, planning, design, development, testing, rollout and maintenance. Write clean, concise, modular and well-tested code. Review code from junior engineers and provide constant and constructive feedback. Contribu ...

Ai Architect

📑 We are looking for an experienced AI Architect to lead the design and implementation of AI-driven solutions across enterprise platforms. This role is critical to the formation and success of the AI Guild and will involve both strategic planning and hands-on development. Job Title: AI Architect Location: Onshore ...

Manager Digital Marketing

📑 Bharat Serums and Vaccines Limited is a leading biopharma company focusing on women’s health, fertility, critical care and emergency medicine. We are a Mankind Pharma Limited Group Company. Mankind Pharma is ranked among the top 3 pharma companies in India. Mankind Pharma has a base multi-speciality therapy busi ...

Senior Manager Strategy & Program Management

📑 About Us : Cashfree Payments is a leader in payments in India. Founded in 2015, Cashfree Payments processes transactions worth $80B annually for more than 800,000 businesses .Businesses use Cashfree Payments to collect payments from 100 payment methods, make payouts, make cross-border payments, improve conversio ...

Back End Developer (SDE 2) Golang

📑 Responsibilities: Successfully and independently deliver large-size projects, including scoping, planning, design, development, testing, rollout and maintenance. Write clean, concise, modular and well-tested code. Review code from junior engineers and provide constant and constructive feedback. Contribute to bui ...

Backend Engineer

📑 About noon We’re building an ecosystem of digital products and services that power everyday life across the Middle East—fast, scalable, and deeply customer-centric. Our mission is to deliver to every door every day. We want to redefine what technology can do in this region, and we’re looking for a Backend Engine ...

Senior Staff Engineer Hardware development

📑 Experience : 10 years Location : Bengaluru, Karnataka Industry : Semi Conductor Working model : Hybrid Role Overview This role is responsible for technical leadership and execution of hardware development for the RH850 Motor Control and Automotive Application Platform. The Sr. Staff Engineer serves as a hardware ...

NoC Verification Engineer

📑 NoC Verification Engineer Experience : 7 to 14 Years Key Responsibilities: Develop UVM-based verification environments for NoC/IP blocks such as FlexNoC, GNOC, or custom NoC fabrics. Define and implement test plans, coverage models, scoreboards, monitors, and checkers for coherent and non-coherent traffic. Integ ...

SAP Tax Engine Manager/Senior

📑 Exp Required: 5 - 12 Years Locations: BLR, CHN, PUN, HYD, NCR, Kolkata, KERALA, COIMBATORE Tech Stack: SAP S/4HANA Vertex (O Series/Accelerators) OR ONESOURCE (GlobalNext) Domain: Indirect Taxation (VAT, Sales & Use Tax, GST) embedded into OTC & PTP flows. Process: Fast-tracked 2-round interview process. Key Ro ...

Senior Quality Assurance Automation Engineer Mobile & Web

📑 About Us: Fluent Health is a dynamic healthcare startup revolutionizing how you manage your healthcare and that of your family. We provide customers with high-quality, personalized options, credible information through trustworthy content, and absolute privacy. To assist us in our growth journey, we are seeking ...

Junior accountant

📑 Location - HyderabadAbout us:Zemoso Technologies is a Software Product Market Fit Studio that brings Silicon Valley-style rapid prototyping and rapid application builds to Entrepreneurs and Corporate innovation. We offer Innovation as a service, working on ideas from scratch and taking them to the produc ...

Senior local it support (senior field service engineer)

📑 This role is ideal for professionals with strong expertise in end-user computing, desktop support, workplace technologies, network troubleshooting, and onsite IT operations who enjoy solving complex technical challenges and delivering exceptional user experiences.Key ResponsibilitiesProvide advanced onsi ...

Manager business intelligence and insights group

📑 Job Summary: Define the vision and roadmap for business intelligence team and champion data culture within Axis Max Life. Lead and enable transformation to embrace automation and providing concise & real-time insights. Responsible for delivery of accurate and timely reports / dashboards. Coach and mento ...

Senior Frontend Developer

📑 Details on tech stack Technical Skills: Strong proficiency in Next.js (Latest, preferable Next 14 and above) and React.js. Have very good exposure on front end architectures. Have a strong Micro Front End experience Proficient in Ja ...

Tools Design Engineer/ Tool designer

📑 Job description As a Tooling / Manufacturing Engineer, you will be responsible for leading the development and industrialization of tooling solutions supporting aircraft structure assembly and manufacturing. The role requires close collaboration with customer, ensuring delivery of high-quality, compliant, and pr ...

Technical Project Manager

📑 Only Immediate - 30 Days candidate is considered. About the Company: We are a leading organization in the IT sector, dedicated to delivering innovative solutions and exceptional service to our clients. Our mission is to empower businesses through technology, fostering a culture of collaboration, integrity, and e ...

Data Engineer

📑 We at Value momentum looking for Data Engineer/ Lead Data Bricks Data Engineer Looking for only Immediate joiners Role: Data Engineer/Lead Data Bricks Data Engineer Experience: 3 –12 Years Employment Type: Permanent Work Mode: W ...

My Paisaa Angular & Ionic Developer

📑 What You'll Do & How You'll Work Build intuitive, responsive user interfaces for web and hybrid mobile apps Work closely with backend developers to deliver features end-to-end Participate in technical and design decisions, balancing ideal solutions ...

Hybrid Cloud Presales Consultant

📑 Hybrid Cloud & Public Cloud Pre-Sales Consultant Location: Noida Experience: 3–12 Years Role Summary Support hybrid cloud pre-sales engagements by designing solutions across on-prem, private, and public cloud environments . Work closely with s ...

Azure Infrastructure Architect

📑 We are looking for a Azure Architect who has expereince in Azure Infrastructure , Application Management and Terraforms Experience : 9 - 14 yrs Shift : Rotational shifts inclusive of night shift and Rotational Week off Location: Chennai, Bangalore and P ...

Steering– Racks/Ceps/Reps/Pinion

📑 Primary Responsibilities Project customer requirements into BOM, drawings, specifications, DFMEA etc. Design and develop steering column products that adhere to industry best practices and as per customer requirements. Design the steering column prod ...

Steering– Racks/Ceps/Reps/Pinion

📑 Primary Responsibilities Project customer requirements into BOM, drawings, specifications, DFMEA etc. Design and develop steering column products that adhere to industry best practices and as per customer requirements. Design the steering column prod ...

Senior Data Architect

📑 Tech Stack: Azure Databricks, Data modelling, PySpark, SQL Mandatory Domin Expertise: Manufacturing, Quality Squad Skills: •TOGAF Certified or equivalent •Deep understanding of the Data architecture discipline, processes, concepts and analytics best practices •Data Solutions ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,069,313+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
Data Engineer ValueMomentum Full-time
Data engineer Healthcare Consulting MNC Full-time
Automation & control engineer Reliance Industries Limited Full-time
Sr. data scientist with snowflake experience SynapOne Full-time
Manager - Business Intelligence and... Axis Max Life Insurance Limited Full-time
Back end developer (sde 2) golang Kredivo Group Full-time
Ai Architect Tata Consultancy Services Full-time
Manager- Digital Marketing Bharat Serums and Vaccines Limited Full-time
Senior Manager - Strategy & Program... Cashfree Payments Full-time
Back End Developer (SDE 2) Golang Kredivo Group Full-time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!