📑 We are seeking an experienced DevOps Engineer to support development, CICD and deploy product to service.The ideal candidate should have expertise and relevant knowledge in Linux OS, Networking, Hardware integration, Shell scripting, Python, Go, Systemd, Kubernetes, Container and Cloud technologies ...
📑 We are looking for a Marketing Operations Manager who will oversee complex marketing workflows, manage our global webinar operations, and serve as the primary administrator for key platforms such as Wrike and Webex. This role requires someone who can balance operational rigor with excellent communication skil ...
📑 Threat Detection EngineerThreat Detection EngineerDo you have a passion for hunting malicious activities in the background of business as usual and figuring out how to detect and respond to new threats?Millennium SOC is going through a transformation, we are looking for an experienced Thr ...
📑 We build breakthrough software products that power digital businesses. We are an innovative product development partner whose solutions drive rapid revenue, market share, and customer growth for industry leaders in Software and SaaS, Media and Publishing, Information Services, and Retail. Our key differentiator ...
📑 Key Responsibilities 1. Product & Process Engineering Lead design, development, and validation of auto components manufactured through MFPD / press forming processes Ensure feasibility of designs with respect to tooling, dies, material sele ...
📑 About the job Mercor connects elite creative and technical talent with leading AI research labs. Headquartered in San Francisco, our investors include Benchmark, General Catalyst, Peter Thiel, Adam D'Angelo</st ...
📑 About the job Mercor connects elite creative and technical talent with leading AI research labs. Headquartered in San Francisco, our investors include Benchmark, General Catalyst, Peter Thiel, Adam D'Angelo</st ...
📑 Technical Lead - Backend About Us: Paytm is India's leading mobile payments and financial services distribution company. Pioneer of the mobile QR payments revolution in India, Paytm builds technologies that help small businesses with payments and commerce. Paytm’s mission is to serve half a billion ...
📑 Job DescriptionWe are looking for a highly skilled Platform DevOps Engineer with a strong development background to join our dynamic engineering team. In this role, you will bridge the gap between software development and IT operations, ensuring the reliability, scalability, and security of our clou ...
📑 The NMIMS School of Branding is a school that approaches all aspects of creativity, marketing, brand building and media communication. We are looking for subject matter experts to instruct in the evolving domain of Digital Media and Marketing Communication. The ideal candidate will display an understanding of ...
📑 Company: Mahindra & Mahindra Ltd Responsibilities & Key Deliverables• Should have Domain knowledge and design experience of Engine cooling system for LCV/Pickup/MPV as per Product Development System• Proficient in base level heat load calculations for engine cooling components and sy ...
📑 This role is for an engineer who would take care of design and development of Lighting systems and optics for electric two wheeler projects. Design and development of Lighting and optics for various vehicle platforms eg. Head Lamp , Tail lamp , Indicators etc. Testing and Validation of sys ...
📑 Job Role: -Azure Data Engineer + Palantir Job Location : Noida/Gurgaon/Hyderabad/Bangalore/Pune Experience :- 5+ Years We are seeking experienced Azure Data Engineers with hands-on ...
📑 Key Responsibilities Requirement Gathering & Functional Analysis Conduct functional workshops with client business users to capture requirements across trade lifecycle, order management, and position/cash management Translate business requirements from trading desks ...
📑 Company DescriptionTrumpet Media is a results-driven digital marketing and web development agency with a strong presence in Jaipur and Bangalore. We specialize in crafting high-impact websites and executing comprehensive 360° marketing strategies tailored to the unique needs of D2 C brands. With a proven tra ...
📑 <div>Overview: </div> <div> </div> <div> <div>TekWissen is a global workforce management provider that offers strategic talent solutions to our clients throughout India and world-wide. Our client is a company operating a marketplace for co ...
📑 Every day, Global Payments makes it possible for millions of people to move money between buyers and sellers using our payments solutions for credit, debit, prepaid and merchant services. Our worldwide team helps over 3 million companies, more than 1,300 financial institutions and over 600 million cardholders ...
📑 Come work at a place where innovation and teamwork come together to support the most exciting missions in the world!Qualys is looking for threat researchers who can leverage their experience and expertise to identify and analyze threats, produce original research publications, and work with engineering ...
📑 Responsibilities Provide Support of the S/4 MigrationSupport setting up and configuring SAP BTPMonitor all SAP systems activity on a daily basisMaintain all SAP system profile configurations, including monitoring and adjusting when problems occur or to improve perfo ...
📑 HARMAN’s engineers and designers are creative, purposeful and agile. As part of this team, you’ll combine your technical expertise with innovative ideas to help drive cutting-edge solutions in the car, enterprise and connected ecosystem. Every day, you will push the boundaries of creative design, and HA ...
📑 Description:Experience: 6+ YearsRole OverviewWe are seeking a highly skilled Senior Software Engineer (SSE) with strong expertise in Power BI, SQL, and Data Warehousing concepts. The ideal candidate will be respons ...
📑 Key Responsibilities: Design and Implement Infrastructure, Develop scalable and secure architecture solutions for deployment, monitoring, and orchestration. Collaborate with development and operations teams to streamline code releases.</p ...
📑 Description & SummaryAt PwC, our people in software and product innovation focus on developing cutting-edge software solutions and driving product innovation to meet the evolving needs of clients. These individuals combine technical experience with creative thinking to deliver innovative sof ...
📑 Overview:·Focuses on one or more major feature sets within the broader D365 domain.·Collaborates with Product Owners, Functional Architects and Development teams that work within the related Delivery teams.·Primarily engages with the delivery teams on current development ini ...
📑 Dreaming big is in our DNA. It’s who we are as a company. It’s our culture. It’s our heritage. And more than ever, it’s our future. A future where we’re always looking forward. Always serving up new ways to meet life’s moments. A future where we keep dreaming bigger. We look for people with passion, t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Principal Security Engineer We’re looking for a Principal Security Enginee r to serve as the technical anchor for Procore’s Security Engineering organization. In this role, you will define the vision for autonomous security sovereignty. You are the strategic lead responsible for building a self-reasoning, self-h ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Job Description: Job Title : SAP Techno-Functional Consultant (ECC 6.0) Shift Timings : 6:30 PM IST- 2:30 AM IST Location : PAN INDIA Remote, hybrid Experience Required : 6 - 10 Years We are se ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 This job is with Amazon, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.DESCRIPTION:Love sports? Want to change the world? Prime Video is re-inventing the live sports experience by merging h ...
📑 Dreaming big is in our DNA. It’s who we are as a company. It’s our culture. It’s our heritage. And more than ever, it’s our future. A future where we’re always looking forward. Always serving up new ways to meet life’s moments. A future where we keep dreaming bigger. We look for people with passion, t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Dreaming big is in our DNA. It’s who we are as a company. It’s our culture. It’s our heritage. And more than ever, it’s our future. A future where we’re always looking forward. Always serving up new ways to meet life’s moments. A future where we keep dreaming bigger. We look for people with passion, t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
📑 Read everything carefully. The requirements and screening questions are critical and if not answered correctly and satisfactorily will result in auto-rejection and waste of your time.Work from Home.This is a full-time role. If you plan to do 2 or more jobs at the same time or want to do this part-t ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 909,741+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Devops Engineer | Qube Cinema | Full-time |
| Marketing Operations Manager -... | Clarivate | Full-time |
| Threat Detection Engineer. | Millennium Management | Full-time |
| Senior AI ML Engineer | 3Pillar Global | Full-time |
| Engineering Head – Auto Parts (MFPD) | Saaki Argus & Averil Consulting | Full-time |
| Customer Support Specialist - Fully Remote | Mercor | Full-time |
| Customer Success Engineer - AI SaaS | Mercor | Full-time |
| Technical Lead -Backend (Gold) | Paytm | Full-time Employment |
| Senior Devops Engineer | Miratech | full-time |
| Assistant Professor - SoBA - Digital... | NMIMS | Unaided |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!