1,069,334+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

Tech Lead

📑 Be a part of our mission! As a world leader in creating comfortable, sustainable, and efficient climate solutions for buildings, homes and transportation, it's our responsibility to put the planet first. For us at Trane Technologies ( , and through our businesses including Tran ...

Software Engineer III

📑 **It's fun to work in a company where people truly BELIEVE in what they're doing!** **Job Description Summary:** The Software Engineer-III designs, develops, troubleshoots, and debugs software programs for software enhancements and new products. Develops software tools including operating syste ...

Senior AI or ML Engineer

📑 **Requisition number:** 2361322**Job category:** Technology Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benef ...

Senior AI or ML Engineer

📑 **Requisition number:** 2361324**Job category:** Technology Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benef ...

Creative Operations Intern

📑 About Us We’re a Gen-Z-focused full-stack entertainment company curating content for audience through culturally relevant content on OTT platforms like Amazon MX Player, JioHotstar and on our YT Channel Alright which is 3.6 Mn+ subscriber strong by (a) in show integration ...

Creative Operations Intern

📑 About Us We’re a Gen-Z-focused full-stack entertainment company curating content for audience through culturally relevant content on OTT platforms like Amazon MX Player, JioHotstar and on our YT Channel ‘Alright‘ which is 3.6 Mn+ subscriber strong by (a) in show integrat ...

Creative Operations Intern

📑 About Us We’re a Gen-Z-focused full-stack entertainment company curating content for audience through culturally relevant content on OTT platforms like Amazon MX Player, JioHotstar and on our YT Channel Alright which is 3.6 Mn+ subscriber strong by (a) in show integration ...

Senior Software Engineering Lead

📑 **Requisition number:** 2341144**Job category:** Technology Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benef ...

CTO & Co Founder

📑 About the Opportunity: We are a founder team with deep, first-hand domain expertise in Human Resources - spanning talent acquisition, performance management, workforce planning, and employee experience. We have identified high-impact, commercially viable gaps in the HR technology ...

Founding Head of Engineering

📑 About the Opportunity: We are a founder team with deep, first-hand domain expertise in Human Resources - spanning talent acquisition, performance management, workforce planning, and employee experience. We have identified high-impact, commercially viable gaps in the HR technology ...

Cto & Co Founder

📑 About the Opportunity: We are a founder team with deep, first-hand domain expertise in Human Resources - spanning talent acquisition, performance management, workforce planning, and employee experience. We have identified high-impact, commercially viable gaps in the HR technology ...

CTO & Co Founder

📑 About the Opportunity: We are a founder team with deep, first-hand domain expertise in Human Resources - spanning talent acquisition, performance management, workforce planning, and employee experience. We have identified high-impact, commercially viable gaps in the HR technology landscape ...

CTO & Co Founder

📑 About the Opportunity: We are a founder team with deep, first-hand domain expertise in Human Resources - spanning talent acquisition, performance management, workforce planning, and employee experience. We have identified high-impact, commercially viable gaps in the HR technolo ...

CTO & Co Founder

📑 About the Opportunity: We are a founder team with deep, first-hand domain expertise in Human Resources - spanning talent acquisition, performance management, workforce planning, and employee experience. We have identified high-impact, commercially viable gaps in the HR technology ...

CTO & Co Founder

📑 About the Opportunity: We are a founder team with deep, first-hand domain expertise in Human Resources - spanning talent acquisition, performance management, workforce planning, and employee experience. We have identified high-impact, commercially viable gaps in the HR technology ...

CTO & Co Founder

📑 About the Opportunity: We are a founder team with deep, first-hand domain expertise in Human Resources - spanning talent acquisition, performance management, workforce planning, and employee experience. We have identified high-impact, commercially viable gaps in the HR technology ...

CTO & Co Founder

📑 About the Opportunity: We are a founder team with deep, first-hand domain expertise in Human Resources - spanning talent acquisition, performance management, workforce planning, and employee experience. We have identified high-impact, commercially viable gaps in the HR technology landscape ...

SOC L1 Analyst

📑 Responsibilities Improves the effectiveness and efficiency of the Security Operations Center (SOC) by leading initiatives that enhance security orchestration, automation, and response (SOAR ). Develop and maintain standard operating procedures (SOPs) and runbooks < ...

Sr. Engineering Manager, Enterprise Automation

📑 As a Senior Engineering Manager in the Revenue Platform Automation division, you’ll lead the engineering efforts driving our Sales, Customer Success (CS), and Finance technology stack. You’ll ensure seamless integration and optimal performance across these platforms, with a strong focus on backend and data-dr ...

SOC L1 Analyst

📑 Responsibilities Improves the effectiveness and efficiency of the Security Operations Center (SOC) by leading initiatives that enhance security orchestration, automation, and response (SOAR). Develop and maintain standard operating procedures (SOPs) and runbooks fo ...

LINUX KERNEL / SYSTEM SOFTWARE ARCHITECT / ENGINEER

📑 About the CompanySamsung Semiconductor India Research (SSIR), BangaloreExperience-5 – 15 YearsAbout the RoleShape the software foundation for next-generation Memory, DRAM, LPDDR, CXL and Accelerator platforms. Work on Linux kernel, system software and host enablement power ...

Senior Azure Data Engineer (ADF, Databricks, PySpark)

📑 Exciting Opportunity Alert! HTC Global Services is hiring Senior Azure Data Engineer (ADF, Databricks, PySpark) for one of our premium projects. Job Summary We are looking for a skilled Senior Azure Data Engineer with strong experience in building scalable data pipel ...

Senior Azure Data Engineer (ADF, Databricks, PySpark)

📑 Exciting Opportunity Alert! 🌟 HTC Global Services is hiring Senior Azure Data Engineer (ADF, Databricks, PySpark) for one of our premium projects.Job SummaryWe are looking for a skilled Senior Azure Data Engineer with strong experience in building scalable data pipelines ...

Senior Backend Developer

📑 Hiring: Senior Backend Engineer | Product Engineering | ImmediateAre you passionate about building scalable backend systems and designing high-performance distributed architectures? Join our team and play a key role in shaping the future of theKogniTwin platform .Position: Senior Backend Engine ...

Senior Azure Data Engineer (ADF, Databricks, PySpark)

📑 Exciting Opportunity Alert! 🌟 HTC Global Services is hiring Senior Azure Data Engineer (ADF, Databricks, PySpark) for one of our premium projects.Job SummaryWe are looking for a skilled Senior Azure Data Engineer with strong experience in building scalable data pipelines ...

Senior Azure Data Engineer (ADF, Databricks, PySpark)

📑 Exciting Opportunity Alert! HTC Global Services is hiring Senior Azure Data Engineer (ADF, Databricks, PySpark) for one of our premium projects. Job Summary We are looking for a skilled Senior Azure Data Engineer with strong experience in building scalable data pipel ...

Technical Lead – Healthcare Platform [8 10 YoE]

📑 Greymatter Innovationz helps you stay digitally relevant across domains, technologies, and skillsets, every day.We are looking forTechnical Lead – Healthcare Platform [8 - 10 YoE]Location: Remote/ Anywhere in IndDuration: FTEWe are looking fo ...

Technical Project Manager

📑 Only Immediate - 30 Days candidate is considered.About the Company:We are a leading organization in the IT sector, dedicated to delivering innovative solutions and exceptional service to our clients. Our mission is to empower businesses through technology, fostering a culture of collaboration, inte ...

Senior Azure Data Engineer (ADF, Databricks, PySpark)

📑 Exciting Opportunity Alert! HTC Global Services is hiring Senior Azure Data Engineer (ADF, Databricks, PySpark) for one of our premium projects. Job Summary We are looking for a skilled Senior Azure Data Engineer with strong experience in building scalable data pipel ...

Sr Snowflake Consultant

📑 Job Title -Sr Snowflake Consultant/ArchitectExperience Required - 6+ YearsTime Zone: 6:30 PM to 3:30 AM ISTWork Mode - RemoteAs an expert in the Snowflake platform, you will collaborate with cross-functional teams to modernize data environments and translate business requirements ...

Senior Azure Data Engineer (ADF, Databricks, PySpark)

📑 Exciting Opportunity Alert! HTC Global Services is hiring Senior Azure Data Engineer (ADF, Databricks, PySpark) for one of our premium projects. Job Summary We are looking for a skilled Senior Azure Data Engineer with strong experience in building scalable data pipel ...

Senior Azure Data Engineer (ADF, Databricks, PySpark)

📑 Exciting Opportunity Alert! HTC Global Services is hiring Senior Azure Data Engineer (ADF, Databricks, PySpark) for one of our premium projects. Job Summary We are looking for a skilled Senior Azure Data Engineer with strong experience in building scalable data pipel ...

Technical Lead – Healthcare Platform [8 10 YoE]

📑 Greymatter Innovationz helps you stay digitally relevant across domains, technologies, and skillsets, every day. We are looking for Technical Lead – Healthcare Platform (8 - 10 YoE) Location: Remote/ Anywhere in Ind Duration: FTE We are looki ...

Senior Azure Data Engineer (ADF, Databricks, PySpark)

📑 Exciting Opportunity Alert! HTC Global Services is hiring Senior Azure Data Engineer (ADF, Databricks, PySpark) for one of our premium projects. Job Summary We are looking for a skilled Senior Azure Data Engineer with strong experience in building scalable data pipel ...

Backend engineer

📑 About noon We're building an ecosystem of digital products and services that power everyday life across the Middle East—fast, scalable, and deeply customer-centric. Our mission is to deliver to every door every day. We want to redefine what technology can do in this region, and we're looking for a Ba ...

Senior Azure Data Engineer (ADF, Databricks, PySpark)

📑 Exciting Opportunity Alert! HTC Global Services is hiring Senior Azure Data Engineer (ADF, Databricks, PySpark) for one of our premium projects. Job Summary We are looking for a skilled Senior Azure Data Engineer with strong experience in building scalable data pipel ...

Technical Lead – Healthcare Platform [8 10 YoE]

📑 Greymatter Innovationz helps you stay digitally relevant across domains, technologies, and skillsets, every day.We are looking forTechnical Lead – Healthcare Platform [8 - 10 YoE]Location: Remote/ Anywhere in IndDuration: FTEWe are looking fo ...

Technical Lead – Healthcare Platform [8 10 YoE]

📑 Greymatter Innovationz helps you stay digitally relevant across domains, technologies, and skillsets, every day. We are looking for Technical Lead – Healthcare Platform (8 - 10 YoE) Location: Remote/ Anywhere in Ind Duration: FTE We are looki ...

Data Engineer

📑 We are looking for aData Engineer (specialized in Databricks)with 3-6 years of experience who can go beyond building pipelines — someone whotranslates analytics logic into reusable, governed data products .The role is for a Healthcare consulting MNC, so pharma domain experience ...

Sr Snowflake Consultant

📑 Job Title -Sr Snowflake Consultant/ArchitectExperience Required - 6+ YearsTime Zone: 6:30 PM to 3:30 AM ISTWork Mode - RemoteAs an expert in the Snowflake platform, you will collaborate with cross-functional teams to modernize data environments and translate business requirements ...

Senior Azure Data Engineer (ADF, Databricks, PySpark)

📑 Exciting Opportunity Alert! HTC Global Services is hiring Senior Azure Data Engineer (ADF, Databricks, PySpark) for one of our premium projects. Job Summary We are looking for a skilled Senior Azure Data Engineer with strong experience in building scalable data pipel ...

Senior Azure Data Engineer (ADF, Databricks, PySpark)

📑 Exciting Opportunity Alert! HTC Global Services is hiring Senior Azure Data Engineer (ADF, Databricks, PySpark) for one of our premium projects. Job Summary We are looking for a skilled Senior Azure Data Engineer with strong experience in building scalable data pipel ...

Sr Snowflake Consultant

📑 Job Title -Sr Snowflake Consultant/ArchitectExperience Required - 6+ YearsTime Zone: 6:30 PM to 3:30 AM ISTWork Mode - RemoteAs an expert in the Snowflake platform, you will collaborate with cross-functional teams to modernize data environments and translate business requirements ...

Sr Snowflake Consultant

📑 Job Title -Sr Snowflake Consultant/ArchitectExperience Required - 6+ YearsTime Zone: 6:30 PM to 3:30 AM ISTWork Mode - RemoteAs an expert in the Snowflake platform, you will collaborate with cross-functional teams to modernize data environments and translate business requirements ...

Senior Azure Data Engineer (ADF, Databricks, PySpark)

📑 Exciting Opportunity Alert! 🌟 HTC Global Services is hiring Senior Azure Data Engineer (ADF, Databricks, PySpark) for one of our premium projects.Job SummaryWe are looking for a skilled Senior Azure Data Engineer with strong experience in building scalable data pipelines ...

Senior Azure Data Engineer (ADF, Databricks, PySpark)

📑 Exciting Opportunity Alert! HTC Global Services is hiring Senior Azure Data Engineer (ADF, Databricks, PySpark) for one of our premium projects. Job Summary We are looking for a skilled Senior Azure Data Engineer with strong experience in building scalable data pipel ...

Senior Azure Data Engineer (ADF, Databricks, PySpark)

📑 Exciting Opportunity Alert! HTC Global Services is hiring Senior Azure Data Engineer (ADF, Databricks, PySpark) for one of our premium projects. Job Summary We are looking for a skilled Senior Azure Data Engineer with strong experience in building scalable data pipel ...

Technical Lead – Healthcare Platform [8 10 YoE]

📑 Greymatter Innovationz helps you stay digitally relevant across domains, technologies, and skillsets, every day.We are looking forTechnical Lead – Healthcare Platform [8 - 10 YoE]Location: Remote/ Anywhere in IndDuration: FTEWe are looking fo ...

Technical Solution Analyst (Support Domain)

📑 Job Profile- Title- Technical Solution Analyst( Support Domain) Location- Bangalore (Hybrid) Exp- 8+ years JD- Roles and Responsibilities: Enable digital transformation of support systems by aligning business, operations and technology ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,069,334+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
Tech Lead Trane Technologies Full-time
Software Engineer III Rocket Software Full-time
Senior AI or ML Engineer UnitedHealth Group Full-time
Senior AI or ML Engineer UnitedHealth Group Full-time
Creative Operations Intern Rusk Media Full-time
Creative Operations Intern Rusk Media Full-time
Creative Operations Intern Rusk Media Full-time
Senior Software Engineering Lead UnitedHealth Group Full-time
CTO & Co Founder Confidential Full-time
Founding Head of Engineering Confidential Full-time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!