📑 Company Summary First American (India) is a GCC (Global Capability Center) of the First American Financial Corporation (NYSE: FAF) family of companies. FAI is a proud member of the FORTUNE 500 companies and has been amongst the Fortune 100 Best Companies to Work For® list for eight conse ...
📑 Design systems and code _ Design technical solutions and perform feasibility studies. _ Propose viable technical solutions to Product Management and/or users for validation. _ Develop software according to Amadeus standards. _ Model, design and implement databases. < ...
📑 · Strong experience in backend development using Java and Spring Boot,building scalable and secure distributed systems · Understanding of core banking and financial domain concepts · Familiar with event-driven architectures and messaging systems (e.g.,JMS, Solace, ActiveM ...
📑 About Rippling Rippling gives businesses one place to run HR, IT, and Finance. It brings to ...
📑 Successful software engineers at Guidewire typically have: A desire to work collaboratively in an empowered, small, cross-functional team Experience working in an agile and fast paced development environment (e.g. TDD, BDD, Agile, pair programming, etc.) A passion fo ...
📑 Roles and Responsibilities Developing, designing and implementing user-facing features while working with the UX team and other developers. Make design and technical decisions for AngularJS - ReactJS projects . Solid knowledge of ReactJs and Typescript, javascript, HTML, CSS <p ...
📑 TeamViewer provides a leading Digital Workplace platform that connects people with technology—enabling, improving and automating digital processes to make work work better. Our software solutions harness the power of AI and shape the future of digitalization. We believe that our diverse teams and stron ...
📑 Job DescriptionWe are seeking a Full Stack Developer to build scalable, cloud-native applications and modern contact center solutions on top of Amazon Connect. The ideal candidate will have strong expertise in frontend technologies, Python backend development, AWS cloud infrastructure, and integrati ...
📑 Role Overview:CDM Smith is seeking a Senior Applications Developer to join our Digital Capital team, focusing on Generative AI and Copilot-driven solutions.You will lead the design, development, and scaling of enterprise-grade applications, integrating Generative AI models into business processes. ...
📑 Description We are looking for a talented Lead Java Engineer with a passion for frontend development using Angular and a solid understanding of backend technologies. We need experienced Engineers who can contribute to critical application and product development projects. Join o ...
📑 We need someone who can build onboarding flows and backend architecture in the same week. Not a frontend dev. Not a backend architect. Someone who owns the platform — design system to database. The role Lead Full Stack Platform Engineer (React · Node.js · AWS · Bootstrap Design System). Remote. Full-time or cont ...
📑 Company Description Zeen Web Solutions is a creative digital agency focused on building innovative websites, robust applications, and AI-driven solutions for clients across industries. The team brings together designers, developers, and strategists who collaborate to transform ideas into impactful digital experi ...
📑 We are seeking a highly skilled and experienced Senior Full stack Developer to join our Engineering Excellence team. This team acts as a force multiplier for our entire engineering organization, championing innovation, promoting best practices, and building the tools and frameworks that enable our developers ...
📑 Job Description Immediate Hiring | Java Full Stack Developer (Azure Mandatory) We are urgently looking for strong Java Full Stack Developers for an immediate client requirement. Please focus only on the below requirement and ensure relevant profiles are shared by 3 PM. ...
📑 The Opportunity Join our “DevOps for Content” revolution as we partner with global brands and agencies to transform their end-to-end creative workflows – from ideation to activation – to deliver AI-powered content services with speed, scale, and governance. Through an AI-first ex ...
📑 Job Summary We are looking for skilled Full Stack Developers with strong experience in ReactJS and NodeJS, along with a good understanding of Java. Candidates with Python exposure will have an added advantage. The ideal candidate should be hands-on, ...
📑 Who We Are At Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a l ...
📑 Hiring Alert | Java Full Stack Developer (Angular + Azure) ? Location: Kochi , Chennai , Greater Noida ? Experience: 5–11 Years ? Interview Date: 23-May-2026 ⚡ Joining Requirement: Candidates should be available to join on or before 26 June 2026 </p ...
📑 At TechBiz Global, we are providing recruitment service to our TOP clients from our portfolio. We are currently seeking a Full-stack developer to join one of our clients ' team. If you're looking for an exciting opportunity to grow in a innovative environment, this could ...
📑 Sr. Full-Stack Engineer (React/Java) Bengaluru Need product based candidate Posted on Sep 12, 2025 TypeScript React Java Spring Boot SQL About the Role Were looking for a passionate Software Engineer to ...
📑 Who We Are At Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a l ...
📑 Company : Quation Solutions Job Description: Lead Full Stack Engineer Location: Bangalore (Whitefield) Experience: 5-8 Years Wo ...
📑 TeamViewer provides a leading Digital Workplace platform that connects people with technology—enabling, improving and automating digital processes to make work work better. Our software solutions harness the power of AI and shape the future of digitalization. We believe that our diverse teams and stron ...
📑 Company Description CloudMoyo is an award-winning and data-driven engineering firm with deep expertise in analytics, application development, digital strategies and generative AI solutions. Our goal is to envision and develop solutions that reinvigorate businesses and build their best f ...
📑 Position Description: We are looking for an experienced Java Full Stack Developer with AWS to join our team. The ideal candidate should be passionate about coding and developing scalable and high-performance applications. You will work closely with our front-end developers, designers, and ...
📑 Strong experience with Python (Lead level ): REST APIs, data pipelines, asynchronous programming, and integrations. Hands-on experience with SQL and working with both structured and unstructured data. Experience with React (Mid level ): Capable of maint ...
📑 Job DescriptionWe are seeking a Full Stack Developer to build scalable, cloud-native applications and modern contact center solutions on top of Amazon Connect. The ideal candidate will have strong expertise in frontend technologies, Python backend development, AWS cloud infrastructure, and integrati ...
📑 Let’s be #BrilliantTogether ISS STOXX is actively hiring for a Full Stack Developer in Java and Angular to join our team in Mumbai (Goregaon East), India. Overview: As a Full Stack Developer at ISS STOXX, you will play a key role in designing, implementing, and mai ...
📑 Job DescriptionWe are seeking a Full Stack Developer to build scalable, cloud-native applications and modern contact center solutions on top of Amazon Connect. The ideal candidate will have strong expertise in frontend technologies, Python backend development, AWS cloud infrastructure, and integrati ...
📑 Skills required 8+ Years Experience Expert in HTML-5, CSS-3 Expert with frontend development stack Angular18 & 19/Typescript/RXJS Experience with backend technologies like SpringBoot , Core Java Experience in CI/CD enviro ...
📑 Job Description Immediate Hiring | Java Full Stack Developer (Azure Mandatory) We are urgently looking for strong Java Full Stack Developers for an immediate client requirement. Please focus only on the below requirement and ensure relevant profiles are shared by 3 PM. ...
📑 Immediate Hiring | Java Full Stack Developer (Azure Mandatory) We are urgently looking for strong Java Full Stack Developers for an immediate client requirement. Please focus only on the below requirement and ensure relevant profiles are shared by 3 PM. Experience & Budget ...
📑 Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you become better every day. We know what it takes to lead UPS into tomorrow—people with a unique combination of skill + passion. ...
📑 Role Overview We are seeking an experienced .NET Full Stack Developer with strong expertise in Desktop Application Development to work on complex, business-critical software products. The ideal candidate will have hands-on experience across the full software development lifecycle, fro ...
📑 Who We Are At Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a l ...
📑 • Extensive knowledge and experience with .NET (4.5 +) C#, WebAPI • Comprehensive knowledge of Software Architectures (OOP, Interfaces, Dependency Injection, IOC containers, N-tier, SOA, and Microservices) • Extensive knowledge and experience with AngularJS (Angular 2.0 and above) • Familiar with ...
📑 Job Description Immediate Hiring | Java Full Stack Developer (Azure Mandatory) We are urgently looking for strong Java Full Stack Developers for an immediate client requirement. Please focus only on the below requirement and ensure relevant profiles are shared by 3 PM. ...
📑 Role: Technical Architect (.Net + angular) Location: Chennai (Remote options available) Roles and Responsibilities Full stack expertise (.Net + Angular) Design and implement scalable, ...
📑 YASH Technologies is a leading technology integrator specializing in helping clients reimagine operating models, enhance competitiveness, optimize costs, foster exceptional stakeholder experiences, and drive business transformation. At YASH, we’re a cluster of the brightest stars working with cutting- ...
📑 Company Introduction Codebase is a young software services company with a great pool of tech-savvy developers. We started in the spring of 2018, and have been growing aggressively. We are located in Pune, India, and serve software product companies across the globe; foc ...
📑 Let’s be #BrilliantTogether ISS STOXX is actively hiring a Senior Full Stack Developer - Java & React for Mumbai (Goregaon East) location. Overview: As a Senior Full Stack Developer, you should have a solid background JAVA and React and will be responsible for de ...
📑 At EY, we’re all in to shape your future with confidence. We’ll help you succeed in a globally connected powerhouse of diverse teams and take your career wherever you want it to go. Join EY and help to build a better working world. Career Family: DE TechOps Role T ...
📑 • Extensive knowledge and experience with .NET (4.5 +) C#, WebAPI • Comprehensive knowledge of Software Architectures (OOP, Interfaces, Dependency Injection, IOC containers, N-tier, SOA, and Microservices) • Extensive knowledge and experience with AngularJS (Angular 2.0 and above) • Familiar with ...
📑 Position Overview As a global leader in 3D design, engineering, and entertainment software, Autodesk helps people imagine, design and create a better world. Autodesk accelerates better design through an unparalleled depth of experience and a broad portfolio of software to give cu ...
📑 Job Description Job description Role Overview Join Experian Automotive and help power one of the industry’s most trusted vehicle data platforms. You’ll design and build high-scale, cloud-native systems that process millions of vehicle history and transaction reques ...
📑 Tätigkeitsbereich:IT/TelekommunikationFachabteilung:Certification & Homologation 1Gesellschaft:Mercedes-Benz Research and Development India Private LimitedStandort:Mercedes-Benz Research and Development India Private Limited, BangaloreStartdatum:sofortVeröffentlichungsdatum:..6Stellennummer:MER3UDQArbeitszeit:Vo ...
📑 Be part of us Innovation is and will always be the core of SAP Fioneer. SAP Fioneer builds on a heritage of outstanding technology and a deep understanding of corporate and consumer demands. At the heart of it all it is simple: We bring financial services to the next level with ...
📑 About the Client: A global leader in the power sector, delivering end-to-end solutions in transmission lines, substations, distribution systems, Role: Software Engineering Lead / Senior Full Stack Engineer Location : I ...
📑 We are seeking a Full Stack Software Engineering & AI to lead the end‑to‑end data product, analytics, and AI transformation of our Life Sciences & Healthcare portfolio. This is a unique opportunity to define and scale customer‑facing data products built on strong software engineering foundations, robust ...
📑 Role: .NET Fullstack Developer Experience: 6 to 12 years Work Mode: Hybrid (2 days office per week) Locations: Bangalore / Pune Mandatory Skills .NET, React, .NET Core ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,494,428+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Staff Software Engineer Full stack - Remote | First American India | Full-time |
| Full stack Dev Java + Angular UI | ScaleneWorks | Full-time |
| Senior Software Engineer-Java Full stack | Terrabit Consulting Pvt. Ltd - India | Full-time |
| Senior Software Engineer - Frontend... | Rippling | Full-time |
| Senior Software Engineer - Full Stack (Java) | Guidewire | Full-time |
| Full Stack Developer ( React JS + .Net) | Confidential | Full-time |
| Senior Full Stack Software Engineer, DEX | TeamViewer Germany GmbH | Full-time |
| Full Stack Engineer (Python and React) | Miratech | Full-time |
| Senior Full Stack Developer - Gen AI | CDM Smith | Full-time |
| Lead Java Full Stack Engineer (Angular) | Epam | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!