909,865+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

Technical Solutions Engineer, Networking (English)

📑 Technical Solutions Engineer, Networking (English) _corporate_fare_ Google _place_ Bengaluru, Karnataka, India; Pune, Maharashtra, India **Early** Experience completing work as directed, and collaborating with teammates; developing knowledge of relevant concepts and processes. <br ...

Practice Customer Engineer, Migrations, Google Cloud

📑 Practice Customer Engineer, Migrations, Google Cloud _corporate_fare_ Google _place_ Gurugram, Haryana, India; Mumbai, Maharashtra, India; +3 more; +2 more **Advanced** Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep experti ...

Senior Software Engineer, Android, YouTube Create

📑 Senior Software Engineer, Android, YouTube Create _corporate_fare_ YouTube _place_ Bengaluru, Karnataka, India **Mid** Experience driving progress, solving problems, and mentoring more junior team members; deeper expertise and applied knowledge within relevant area. **Minimum ...

Technical Solutions Engineer, Networking (English)

📑 Technical Solutions Engineer, Networking (English) _corporate_fare_ Google _place_ Bengaluru, Karnataka, India; Pune, Maharashtra, India **Early** Experience completing work as directed, and collaborating with teammates; developing knowledge of relevant concepts and processes. <br ...

Technical Solutions Engineer, Networking (English)

📑 Technical Solutions Engineer, Networking (English) _corporate_fare_ Google _place_ Bengaluru, Karnataka, India; Pune, Maharashtra, India **Mid** Experience driving progress, solving problems, and mentoring more junior team members; deeper expertise and applied knowledge within relevant ...

Practice Customer Engineer, Migrations, Google Cloud

📑 Practice Customer Engineer, Migrations, Google Cloud _corporate_fare_ Google _place_ Gurugram, Haryana, India; Mumbai, Maharashtra, India; +3 more; +2 more **Advanced** Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep experti ...

Software Engineering Intern, Summer 2027

📑 Software Engineering Intern, Summer 2027 _corporate_fare_ Google _place_ Bengaluru, Karnataka, India; Hyderabad, Telangana, India; +2 more; +1 more _bar_chart_ Intern & Apprentice _info_outline_ XPlease complete your application before June 28th, 2026. **Who Should Apply?* ...

Senior Software Engineer

📑 Senior Software Engineer _corporate_fare_ Google _place_ Bengaluru, Karnataka, India **Mid** Experience driving progress, solving problems, and mentoring more junior team members; deeper expertise and applied knowledge within relevant area. **Minimum qualifications:** <br ...

Senior Software Engineer, Enterprise Knowledge Platform

📑 Senior Software Engineer, Enterprise Knowledge Platform _corporate_fare_ Google _place_ Hyderabad, Telangana, India **Mid** Experience driving progress, solving problems, and mentoring more junior team members; deeper expertise and applied knowledge within relevant area. **Min ...

Staff Software Engineer, Google SDN Control plane

📑 Staff Software Engineer, Google SDN Control plane _corporate_fare_ Google _place_ Bengaluru, Karnataka, India **Advanced** Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep expertise in domain. **Minimum qualification ...

Software Engineering Intern, Summer 2027

📑 Software Engineering Intern, Summer 2027 _corporate_fare_ Google _place_ Bengaluru, Karnataka, India; Hyderabad, Telangana, India; +2 more; +1 more _bar_chart_ Intern & Apprentice _info_outline_ XPlease complete your application before June 28th, 2026. **Who Should Apply?* ...

Platform Customer Engineer

📑 Platform Customer Engineer _corporate_fare_ Google _place_ Mumbai, Maharashtra, India; Pune, Maharashtra, India **Mid** Experience driving progress, solving problems, and mentoring more junior team members; deeper expertise and applied knowledge within relevant area. _info_out ...

Software Engineering Intern, Summer 2027

📑 Software Engineering Intern, Summer 2027 _corporate_fare_ Google _place_ Bengaluru, Karnataka, India; Hyderabad, Telangana, India; +2 more; +1 more _bar_chart_ Intern & Apprentice _info_outline_ XPlease complete your application before June 28th, 2026. **Who Should Apply?* ...

Product Support Consultant, Ads Billing

📑 Product Support Consultant, Ads Billing _corporate_fare_ Google _place_ Gurugram, Haryana, India; Hyderabad, Telangana, India **Mid** Experience driving progress, solving problems, and mentoring more junior team members; deeper expertise and applied knowledge within relevant area. ...

Senior Software Engineer

📑 **Job Summary:** As a Senior Software Engineer, you will be responsible for designing, developing, and delivering high-quality software solutions. Work with a cross functional team, which includes developers, product managers, QA engineers, and product owners, to implement solutions tightly aligned with ...

Staff Devops Engineer Moveworks

📑 **Moveworks** is the Agentic AI Assistant platform that empowers the entire workforce. Our platform enables employees to converse with all of their business systems through natural language to quickly find answers and automate tasks. Powered by the world's most advanced LLMs, our proprietary models, a ...

Software Engineer/AI ML

📑 IND Software Engineer - GCC095We’re determined to make a difference and are proud to be an insurance company that goes well beyond coverages and policies. Working here means having every opportunity to achieve your goals – and to help others accomplish theirs, too. Join our team as we help shape the future.< ...

Senior Software Engineer/AI ML

📑 IND Software Engineer - GCC095We’re determined to make a difference and are proud to be an insurance company that goes well beyond coverages and policies. Working here means having every opportunity to achieve your goals – and to help others accomplish theirs, too. Join our team as we help shape the future.< ...

Senior Software Engineer/AI ML

📑 IND Software Engineer - GCC095We’re determined to make a difference and are proud to be an insurance company that goes well beyond coverages and policies. Working here means having every opportunity to achieve your goals – and to help others accomplish theirs, too. Join our team as we help shape the future.< ...

Software Engineering Associate Advisor HIH Evernorth

📑 **INTRODUCTION TO EVERNORTH:** Evernorth Health Services India, established in Hyderabad in 2024, is an innovation hub for Evernorth Health Services, the pharmacy, care and benefits division of The Cigna Group. The innovation hub will support innovation-focused areas, such as generative AI, product deve ...

Application Development Advisor HIH Evernorthh

📑 **Application Development Advisor – Production Support** **Position Overview** Are you looking for an opportunity to engineer & support modern application, Continuous Deployment/Continuous Integration, and embedded solutions(UI Development/Claim Engine processing/Backend development/AI Int ...

Staff Devops Engineer Moveworks

📑 **Moveworks** is the Agentic AI Assistant platform that empowers the entire workforce. Our platform enables employees to converse with all of their business systems through natural language to quickly find answers and automate tasks. Powered by the world's most advanced LLMs, our proprietary models, a ...

Senior Analyst, Strategy Monitoring & Analytics (L09)

📑 **Title** - Senior Analyst, Strategy Monitoring & Analytics (L09) **Company Overview:** Synchrony (NYSE: SYF) is a premier consumer financial services company delivering one of the industry’s most complete digitally enabled product suites. Our experience, expertise and scale encompass a broad spectrum ...

Software Engineering Associate Advisor HIH Evernorth

📑 **INTRODUCTION TO EVERNORTH:** Evernorth Health Services India, established in Hyderabad in 2024, is an innovation hub for Evernorth Health Services, the pharmacy, care and benefits division of The Cigna Group. The innovation hub will support innovation-focused areas, such as generative AI, product deve ...

Senior Software Engineer Specialist(C++)

📑 Imagine yourself… + Growing your expertise and expanding your skillset with every project.+ Collaborating with a vibrant, inclusive, global team.+ Contributing to a brighter, more sustainable future. It’s all possible with a role at Esko ( . Es ...

Enterprise Applications Engineer

📑 **LiveRamp is the data collaboration platform of choice for the world’s most innovative companies. A groundbreaking leader in consumer privacy, data ethics, and foundational identity, LiveRamp is setting the new standard for building a connected customer view with unmatched clarity and context while protecting p ...

Enterprise Applications Engineer

📑 **LiveRamp is the data collaboration platform of choice for the world’s most innovative companies. A groundbreaking leader in consumer privacy, data ethics, and foundational identity, LiveRamp is setting the new standard for building a connected customer view with unmatched clarity and context while protecting p ...

Senior Software Engineer

📑 **Overview** **About Business Unit:** SaaSOps leads post-production support and the overall experience of Epsilon PeopleCloud products for our global clients. This function is responsible for product support, incident management, managed operations and the automation of processes. The team has ...

Lead Software Engineer

📑 **Overview** **About Business Unit:** The Product team forms the crux of our powerful platforms and helps connect millions of customers worldwide with the brands that matter most to them. This team of innovative problem solvers develops and builds products that position Epsilon as a differentia ...

Senior Software Engineer

📑 **Overview** **About Business Unit:** The Product team forms the crux of our powerful platforms and helps connect millions of customers worldwide with the brands that matter most to them. This team of innovative problem solvers develops and builds products that position Epsilon as a differentia ...

Staff Software Engineer

📑 **Overview** **About Business Unit:** The Product team forms the crux of our powerful platforms and helps connect millions of customers worldwide with the brands that matter most to them. This team of innovative problem solvers develops and builds products that position Epsilon as a differentia ...

Senior Software Engineer

📑 **Overview** **About Business Unit:** The Product team forms the crux of our powerful platforms and helps connect millions of customers worldwide with the brands that matter most to them. This team of innovative problem solvers develops and builds products that position Epsilon as a differentia ...

Lead Software Engineer

📑 **Overview** **About Business Unit:** The Product team forms the crux of our powerful platforms and helps connect millions of customers worldwide with the brands that matter most to them. This team of innovative problem solvers develops and builds products that position Epsilon as a differentia ...

Senior Staff Software Engineer

📑 **Overview** **About Business Unit:** The Product team forms the crux of our powerful platforms and helps connect millions of customers worldwide with the brands that matter most to them. This team of innovative problem solvers develops and builds products that position Epsilon as a differentia ...

Staff, Software Engineer

📑 **Overview** **About Business Unit:** The Product team forms the crux of our powerful platforms and helps connect millions of customers worldwide with the brands that matter most to them. This team of innovative problem solvers develops and builds products that position Epsilon as a differentia ...

Senior Software Engineer

📑 **Overview** **About Business Unit:** The Product team forms the crux of our powerful platforms and helps connect millions of customers worldwide with the brands that matter most to them. This team of innovative problem solvers develops and builds products that position Epsilon as a differentia ...

Principal Architect Apps & AI

📑 **Overview** Microsoft Industry Solutions – Global Center Innovation and Delivery Center (GCID) delivers end-to-end solutions by enabling accelerated adoption and productive use of Microsoft technologies. An organization of well over 1000+ exceptional people, GCID presents a compelling opportunity for s ...

Senior Engineer Software, Backend

📑 Paylocity is an award-winning provider of cloud-based HR and payroll software solutions, offering the most complete platform for the modern workforce. The company has become one of the fastest-growing HCM software providers worldwide by providing an intuitive, easy-to-use product suite that helps businesses auto ...

Senior Software Engineer (Golang)

📑 **_Welcome to Warner Bros. Discovery… the stuff dreams are made of._** **Who We Are…** When we say, “the stuff dreams are made of,” we’re not just referring to the world of wizards, dragons and superheroes, or even to the wonders of Planet Earth. Behind WBD’s vast portfolio of iconic content an ...

Senior Software Engineer (Golang)

📑 **_Welcome to Warner Bros. Discovery… the stuff dreams are made of._** **Who We Are…** When we say, “the stuff dreams are made of,” we’re not just referring to the world of wizards, dragons and superheroes, or even to the wonders of Planet Earth. Behind WBD’s vast portfolio of iconic content an ...

Network Implementation Engineer, Edge Delivery Singapore or Bengaluru

📑 Network Implementation Engineer, Edge Delivery - Singapore or Bengaluru _corporate_fare_ Google _place_ Singapore; Bengaluru, Karnataka, India **Mid** Experience driving progress, solving problems, and mentoring more junior team members; deeper expertise and applied knowledge within re ...

Software Development Engineer, CAM

📑 DescriptionRetail Business Services (RBS) supports Amazon’s Retail business growth WW through three core tasks. These are (a) Selection, where RBS sources, creates and enrich ASINs to drive GMS growth; (b) Defect Elimination: where RBS resolves inbound supply chain defects and develops root cause fixes to im ...

Software Development Engineer II, Aurora Open Source Engines

📑 DescriptionAWS Utility Computing (UC) provides product innovations — from foundational services such as Amazon’s Simple Storage Service (S3) and Amazon Elastic Compute Cloud (EC2), to consistently released new product innovations that continue to set AWS’s services and features apart in the industry. As a me ...

Software Development Engineer, CAM

📑 DescriptionRetail Business Services (RBS) supports Amazon’s Retail business growth WW through three core tasks. These are (a) Selection, where RBS sources, creates and enrich ASINs to drive GMS growth; (b) Defect Elimination: where RBS resolves inbound supply chain defects and develops root cause fixes to im ...

Engineering Manager, AI Solutions

📑 Company Description Working at Allegis Global Solutions (AGS) is more than just a job. It’s a career. It’s a community of people who invest in your development and empower you to blaze your own trail. Each of us is here to create real, measurable impact that moves needles. We operate beyond roles or ...

Software Development Engineer II, Aurora Open Source Engines

📑 DescriptionAWS Utility Computing (UC) provides product innovations — from foundational services such as Amazon’s Simple Storage Service (S3) and Amazon Elastic Compute Cloud (EC2), to consistently released new product innovations that continue to set AWS’s services and features apart in the industry. As a me ...

Senior Software Development Engineer, Aurora PostgreSQL

📑 DescriptionAWS Utility Computing (UC) provides product innovations — from foundational services such as Amazon’s Simple Storage Service (S3) and Amazon Elastic Compute Cloud (EC2), to consistently released new product innovations that continue to set AWS’s services and features apart in the industry. As a me ...

Software Development Engineer II, Aurora Open Source Engines

📑 DescriptionAWS Utility Computing (UC) provides product innovations — from foundational services such as Amazon’s Simple Storage Service (S3) and Amazon Elastic Compute Cloud (EC2), to consistently released new product innovations that continue to set AWS’s services and features apart in the industry. As a me ...

Software Development Engineer II, Aurora Open Source Engines

📑 DescriptionAWS Utility Computing (UC) provides product innovations — from foundational services such as Amazon’s Simple Storage Service (S3) and Amazon Elastic Compute Cloud (EC2), to consistently released new product innovations that continue to set AWS’s services and features apart in the industry. As a me ...

Senior Software Development Engineer, Aurora PostgreSQL

📑 DescriptionAWS Utility Computing (UC) provides product innovations — from foundational services such as Amazon’s Simple Storage Service (S3) and Amazon Elastic Compute Cloud (EC2), to consistently released new product innovations that continue to set AWS’s services and features apart in the industry. As a me ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 909,865+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
Technical Solutions Engineer,... Google Full-time
Practice Customer Engineer,... Google Full-time
Senior Software Engineer, Android,... Google Full-time
Technical Solutions Engineer,... Google Full-time
Technical Solutions Engineer,... Google Full-time
Practice Customer Engineer,... Google Full-time
Software Engineering Intern, Summer 2027 Google Full-time
Senior Software Engineer Google Full-time
Senior Software Engineer, Enterprise... Google Full-time
Staff Software Engineer, Google SDN... Google Full-time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!