📑 Job Logistics Summary: Position: Full Stack Engineer Type: Full-Time (Hybrid) Location: India, Bengaluru Who We Are: SellCord is the largest Walmart-exclusive agency dedicated to he ...
📑 Job Description Job Description – Tech Lead (Polyglot Full Stack & Intelligent Systems) We are seeking a highly capable Tech Lead with strong experience in full stack software development, cloud-native platforms, industrial system digitization, and intelligent softwar ...
📑 About the Role:We are seeking an experienced Java Full Stack Developer with strong expertise in backend andfrontend technologies. The ideal candidate will be proficient in Java, Spring Boot, , and, and capable of delivering scalable, high-performance applications.Key Responsibilities:- Design, develop, and maint ...
📑 Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with m ...
📑 Job Description Java Full Stack Developer – Angular + Azure Service s Location: Chennai Interview Date: 23-May-2026 Mode: Face-to-Face Requirements Mandatory Skills: ✔ Java < ...
📑 Role - Full Stack Developer Work Experience – 3-5 Yrs Location- Mumbai Key skills -.Netcore, Reactjs Skills • More than 2 years of working experience with .net core • More than 2 years of ...
📑 About Newton: Newton School of Technology (NST) is a new-age institution redefining technical education in India. Founded by IIT alumni, NST offers a 4-year B. Tech in Computer Science and AI, focused on hands-on learning and deep industry integration. Within two years, over 93% of students have secured paid int ...
📑 AWS Full Stack SDE (Mid/Junior Level) Location: Hyderabad (Work from Office) Employment Type: Full-Time Experience: 2–6 Years Role Overview We are hiring AWS Full Stack Software Development Engineers (SDEs) to work on enterprise-scale cloud-native applications involving backend APIs, microservices, AWS services, ...
📑 We’re a US based tech startup. We are looking for AI+Full stack developers. You’ll work on a real production system involving: Multi-agent workflows (Discovery, Deep Dive, Filters, Reports) Stateful AI systems with memory and context Real-world ...
📑 Position _ Full Stack Developer Work Timings _ 2pm to 11pm IST Years of Exp 6-7 years Tech Stack: Backend: .NET, SQL, API Frontend: React (or strong expertise in Angular/Bootstrap with a ...
📑 Our team members are at the heart of everything we do. At Cencora, we are united in our responsibility to create healthier futures, and every person here is essential to us being able to deliver on that purpose. If you want to make a difference at the center of health, come join our innovative company and hel ...
📑 Job Description Full Stack Developer (React, Node.js, NoSQL, SQL) – Table-Side Food Ordering App Timings : 04:30PM- 12:30AM Location : Hyderabad (Work from office) Notice : Immediately available This is a co ...
📑 Description We are looking for a Java Full Stack Developer to join our team for a new project focused on creating a web application using the latest Java technologies. As a Java Developer, you will be responsible for designing and implementing high-quality code that mee ...
📑 Primary Skills: Java-Expert, Full Stack-Advanced, Spring Boot-Expert, Angular-Advanced, Cloud (IBM)-Intermediate Contract Type: Permanent Location: Chennai Job Summary: This position is for a Senior Full Stack Java Developer responsible for developing and managin ...
📑 Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with m ...
📑 Full Stack Software Engineer (AWS | EKS | ArgoCD) 6 to 9 years of Experience Key Requirements: Strong experience with React.js or Next.js Hands-on AWS EKS and ArgoCD experience Docker & Kubernetes knowledge A ...
📑 About Northern Trust: Northern Trust, a Fortune 500 company, is a globally recognized, award-winning financial institution that has been in continuous operation since 1889. Northern Trust is proud to provide innovative financial services and guidance to the world’s most successful indivi ...
📑 Nasdaq Technology is looking for a passionate Full stack Software Engineer Specialist with focus on AWS Cloud SaaS Java and React Development, to join the Mumbai technology center in India. If Innovation and effectiveness drive, you forward this is the place for you!Nasdaq is continuously revolutionizi ...
📑 Who We Are At Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a l ...
📑 About Northern Trust: Northern Trust, a Fortune 500 company, is a globally recognized, award-winning financial institution that has been in continuous operation since 1889. Northern Trust is proud to provide innovative financial services and guidance to the world’s most successful indivi ...
📑 Job Description Hiring Alert | .NET Full Stack Developer – Angular/React + Azure Location: Chennai, Hyderabad, Noida, Pune, Kochi Interview Date: 23-May-2026 Mode: Face-to-Face Requirements Mandatory Skills: .NET C ...
📑 At EY, we’re all in to shape your future with confidence. We’ll help you succeed in a globally connected powerhouse of diverse teams and take your career wherever you want it to go. Join EY and help to build a better working world. Career Family : DE TechOps Role ...
📑 Job Description Full Stack Developer (React, Node.js, NoSQL, SQL) – Table-Side Food Ordering App Timings : 04:30PM- 12:30AM Location : Hyderabad (Work from office) Notice : Immediately available This is a co ...
📑 Spreetail propels brands to increase their ecommerce market share across the globe while improving their operational costs. Learn how we are building one of the fastest-growing ecommerce companies in history: . Our teams build scalable, reliable, and cutting-edge software to propel Spreetail to being a top ecomm ...
📑 We are seeking a multi-skilled, multi-faceted Technical Architect with a deep expertise in Large Language models, Generative AI, but also with Full-Stack Cloud Native Application Development and Cloud Engineering, to join our dynamic product development team. As a Technical Architect, you will play a key ro ...
📑 It's fun to work in a company where people truly BELIEVE in what they are doing! If you like wild growth and working with happy, enthusiastic over-achievers, you'll enjoy your career with us! Hiring Related Queries This inbox does not process resume submissions. Al ...
📑 We are seeking a Full Stack Python Developer with strong experience in both frontend and backend development, and deep familiarity with Azure Cloud and serverless architecture. In this full-time role, you’ll build modern, scalable web applications and services using Python, JavaScript frameworks, and Azure-nativ ...
📑 About Northern Trust: Northern Trust, a Fortune 500 company, is a globally recognized, award-winning financial institution that has been in continuous operation since 1889. Northern Trust is proud to provide innovative financial services and guidance to the world’s most successful indivi ...
📑 Hiring: Java Full Stack Developer (Vue 3 Expert) Location: PAN India (Remote) Salary: Up to 40 LPA Experience: 7–10 Years We are hiring a highly skilled Java Full Stack Developer with strong expertise in Vue 3 and enterprise-grade application developme ...
📑 Job Code: MACIN11215 Role: Full Stack Developer (Senior & Lead Level) Type of Commute: Remote Skill Set: .Net core, Restful API, CI/CD Pipelines, AWS Desired Industry Experience: 5 ...
📑 It's fun to work in a company where people truly BELIEVE in what they are doing! If you like wild growth and working with happy, enthusiastic over-achievers, you'll enjoy your career with us! Hiring Related Queries This inbox does not process resume submissions. Al ...
📑 As a Custom Software Engineer, a typical day involves leading the design, construction, and configuration of software applications. We are looking for Senior Java Developer. This role requires taking ownership of the development process and serving as the main liaison for project-related communications. The posi ...
📑 Requirements and Skills : 6 to 12 yeasr experience as a Full Stack Engineer or similar role Experience developing Web and Mobile applications Familiarity with common technology stacks Knowledge of multiple front-end languages and libraries (e.g., HTML, CSS, JavaScript, TypeScript) Knowledge of Java p ...
📑 Full Time Employment Work type : Remote working Shift timings 2pm to 11pm 6 to 9 years of Experience Corporate office Location : Visakhapatnam, Andhrapradesh <st ...
📑 Job Description Hiring: Quality Engineer – Full Stack (Agentic AI / Python) Locations: Bangalore | Kolkata Experience: 7+ Years We are looking for a highly skilled Quality Engineer with strong experience in Full Stack testing and modern AI-driven applications, ...
📑 Hiring: Quality Engineer – Full Stack (Agentic AI / Python) Locations: Bangalore | Kolkata Experience: 7+ Years We are looking for a highly skilled Quality Engineer with strong experience in Full Stack testing and modern AI-driven applications, especially Python-based Ag ...
📑 FICO (NYSE: FICO) is a leading global analytics software company, helping businesses in 100+ countries make better decisions. Join our world-class team today and fulfill your career potential! The Opportunity Come join our product development team in a hands-on technical role wh ...
📑 HARMAN’s engineers and designers are creative, purposeful and agile. As part of this team, you’ll combine your technical expertise with innovative ideas to help drive cutting-edge solutions in the car, enterprise and connected ecosystem. Every day, you will push the boundaries of creative design, and HA ...
📑 What’s important to us: We are seeking a Lead Full Stack Developer who will understand the need to achieve a balance between innovation and the most appropriate solution for our clients. One should be passionate about their work, eager to learn and grow, and who is committed to deliveri ...
📑 Position: Senior Full Stack Developer - Technology, Digital Business Purpose: This position will be responsible for development and ship high performance which helps us deliver awesome experience to our end users Education: Bachelor’s/Master’s degree or equival ...
📑 Technical Specialist/Full Stack (AI, Python)_2232 Overall Objectives of Job: Qualifications & Experience Bachelor’s degree in Computer Science, Engineering, or a related field. 6 - 8 years of overall IT experience, with 2- ...
📑 Job Details Requirement Type Permanent Job Title Java Full Stack Developer (Spring boot + react) Job Level Middle Management Job Description No. of Openings 6 Job Domain IT Experience - Minimum - Maximum / ( regular), BCA, MSc Specialisation Skills Full Stack Java Developer, Backe ...
📑 Job Description Req ID: NTT DATA strives to hire exceptional, innovative and passionate individuals who want to grow with us. If you want to be part of an inclusive, adaptable, and forward-thinking organization, apply now. We are currently seeking a Full Stack ...
📑 We’re a US based tech startup. We are looking for AIFull stack developers. You’ll work on a real production system involving: Multi-agent workflows (Discovery, Deep Dive, Filters, Reports) Stateful AI systems with memory and context Real-world partner sourcing and analysis pipelines Example of our system archite ...
📑 We’re a US based tech startup. We are looking for AI+Full stack developers.You’ll work on a real production system involving:Multi-agent workflows (Discovery, Deep Dive, Filters, Reports)Stateful AI systems with memory and contextReal-world partner sourcing and analysis pipelinesExample of ou ...
📑 AWS Full Stack SDE (Mid/Junior Level)Location: Hyderabad (Work from Office)Employment Type: Full-TimeExperience: 2–6 YearsRole OverviewWe are hiring AWS Full Stack Software Development Engineers (SDEs) to work on enterprise-scale cloud-native applications involving backend APIs, microservices ...
📑 About the role Navitas is seeking an innovative, and high-performing Senior Full-Stack WordPress Web Developer with significant front-end development experience, expertise in custom WordPress theme and plugin development, and advanced English language skills. The primary purpose of this ...
📑 Job DescriptionWe are seeking a highly motivated Junior PHP Full Stack Engineer to join our dynamic team. As part of our team, you will have the opportunity to work on exciting projects, contribute to innovative solutions, and grow your career in a collaborative environment. <p ...
📑 Full Stack Web Developer (Python | React | MySQL) Are you passionate about building scalable web applications and experimenting with cutting-edge coding techniques like Vibe Coding (Claude Code)? We're looking for a talented Full Stack Developer to join our dynamic team at Birlasoft. </p ...
📑 Description We’re looking for a Senior Full Stack Engineer to build high performance, cloud native systems. This role blends strong backend engineering with Java/Spring, front end development with React, and modern DevOps practices across Azure. Technical Skills (Must Have) < ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,494,382+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Senior Full Stack Engineer -... | SellCord | Full-time |
| Tech Lead (Polyglot Full Stack &... | ePropelled | Full-time |
| Urgent Requirement For Full Stack... | Tech RBM Inc | Full-time |
| Lead Software Engineer (Java Full... | Epam | Full-time |
| Java Full Stack Developer – Angular... | Vrinda International | Full-time |
| Mobile Programming-Full Stack... | Nexthire | Full-time |
| SDE 3 Lead Instructor - Full stack... | Newton School of Technology | Full-time |
| AWS Full Stack SDE (Mid/Junior Level) | People Tech Group Inc | Full-time |
| AI Agent and full stack development... | TrueGether | Full-time |
| HIC GLOBAL - ALGOTALE -FULL STACK... | Nexthire | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!