📑 Build the future of digital interaction. Hamilton Bradshaw Group is launching an exciting new venture focused on creating an AI-powered conversational avatar that looks, sounds, and responds like a real person. We're seeking an experienced Full-Stack AI Engineer / Technical Le ...
📑 Discover your future at CitiWorking at Citi is far more than just a job. A career with us means joining a team of more than 230,000 dedicated people from around the globe. At Citi, you’ll have the opportunity to grow your career, give back to your community and make a real impact.Job OverviewFull Stack Software ...
📑 Build the future of digital interaction.Hamilton Bradshaw Group is launching an exciting new venture focused on creating an AI-powered conversational avatar that looks, sounds, and responds like a real person.We're seeking an experienced Full-Stack AI Engineer / Tec ...
📑 About CheckmateCheckmate is a restaurant technology solution provider that has continually evolved over time. We started in 2017 by integrating 3rd party platforms to the POS systems of restaurants. At that time, there were multiple 3rd party platforms like GrubHub, UberEats, DoorDash, ...
📑 Work type: Office/Remote Technical Level: Senior Job Category: Software Development Looking for a company that inspires passion, courage, and innovation? With our client, you can help shape the future of global commerce, influencing how millions of people buy, sell, connect, and share wor ...
📑 <div>Description:</div> <br> <div> <div class="olUlHelper sap-padding-begin-tiny"> <p style="margin: 0in 0in 8pt; line-height: 107%; font-size: 11pt; font-family: Calibri, sans-serif;">Experience</p> <p style="margin: 0in 0i ...
📑 We’re looking for a strong Senior Software Engineer with a passion for engineering to join our Product team to help us scale our platform and deliver cutting edge capabilities to our customers. This person will be an integral part of the team that designs, builds and innovates our product. The right candidate ...
📑 Company: Manhattan Tech Ventures Pvt. Ltd.Location: Remote (India)Job Type: Full-timeAbout the RoleManhattan Tech Ventures Pvt. Ltd. is looking for an experienced and highly skilled Senior Full ...
📑 Company: Manhattan Tech Ventures Pvt. Ltd.Location: Remote (India)Job Type: Full-timeAbout the RoleManhattan Tech Ventures Pvt. Ltd. is looking for an experienced and highly skilled Senior Full ...
📑 Company: Manhattan Tech Ventures Pvt. Ltd.Location: Remote (India)Job Type: Full-timeAbout the RoleManhattan Tech Ventures Pvt. Ltd. is looking for an experienced and highly skilled Senior Full ...
📑 Associate Consultant -delivery( Dot NET Full Stack Developer) Date posted 12/21/ Location Pune | India, Chennai | India Company Worldline This is WorldlineWe are the innovators at the heart of the payments technology industry, shaping how the world pays and get ...
📑 Location: ChennaiMinimum 8–12 years of experience in full stack development with strong expertise in Java, API development, and modern front-end technologies. Proven track record in building enterprise-scale web applications, RESTful services, and scalable microservices.Roles and Responsibilities: ...
📑 Description: Experience 6 8 Years Job Summary We are seeking an experienced Java Microservices Developer with 6 8 years of hands-on experience in designing, developing, and deploying enterprise-grade applications. The ideal candidate should ...
📑 **ABOUT AMGEN** Amgen harnesses the best of biology and technology to fight the world’s toughest diseases, and make people’s lives easier, fuller and longer. We discover, develop, manufacture and deliver innovative medicines to help millions of patients. Amgen helped establish the biotechnology industry ...
📑 **ABOUT AMGEN** Amgen harnesses the best of biology and technology to fight the world’s toughest diseases, and make people’s lives easier, fuller and longer. We discover, develop, manufacture and deliver innovative medicines to help millions of patients. Amgen helped establish the biotechnology industry ...
📑 **ABOUT AMGEN** Amgen harnesses the best of biology and technology to fight the world’s toughest diseases, and make people’s lives easier, fuller and longer. We discover, develop, manufacture and deliver innovative medicines to help millions of patients. Amgen helped establish the biotechnology industry ...
📑 **Job Requisition ID #** 26WD97977 **Position Overview** Autodesk Platform Service and Emerging Technology (UDA)team is looking for Senior Software Engineer -full stack talents to develop AI powered core components that to empower millions of customers to search for and access any of t ...
📑 The Applications Development Senior Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute to applic ...
📑 We are seeking a highly skilled and motivated Full Stack Developer with 8-12 years of comprehensive development experience. The ideal candidate will possess deep expertise in Java-based backend development, coupled with strong proficiency in React.js for building robust and intuitive user interfaces. This role r ...
📑 The Production Engineer is a pivotal role within Citi's Technology organisation, responsible for designing, building, and operating the intelligent systems that underpin our global production environment. This is an engineering-first position at the intersection of software craftsmanship, AI-native development, ...
📑 **Python Software Engineer - Generative AI Products and Platform - Vice President** **- C13 – Pune** **The Opportunity** This is your chance to build the foundational applications systems for 'Citi Assist', a Generative AI assistant that will reach every Citi employee globally. As part of the ...
📑 **Meet the Team** The Cisco Wireless Feature & System Engineering team builds end-to-end wireless capabilities across access points, controllers, and cloud-managed platforms. We design features that span device software, control planes, and management systems to deliver seamless, secure, and high-perfor ...
📑 **Senior Java Full Stack Developer - Assistant Vice President** is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute ...
📑 **Senior Java Full Stack Developer - Assistant Vice President** is an intermediate management level position responsible for providing full leadership and direction to a team of employees in an effort to establish and implement new or revised application systems and programs in coordination with the Technology ...
📑 Full Stack Engineer / Associate Director Fullstack Software Engineering Location:Pune, MH, IN, 411006 Brand: HSBC Area of Interest: Technology Closing Date: Hybrid Worker Date: 7 Jun 2026 **Job description** Some careers shine brighter than othe ...
📑 Full Stack Engineer / Associate Director Fullstack Software Engineering Location:Pune, MH, IN, 411006 Brand: HSBC Area of Interest: Technology Closing Date: Hybrid Worker Date: 7 Jun 2026 **Job description** Some careers shine brighter than othe ...
📑 **Introduction**India Systems Development Lab (ISDL) is part of IBM Infrastructure world-wide technology development lab. Established in 1996, the Lab is headquartered in India's Silicon Valley and startup hub - Bengaluru, with a strong presence in Pune and Hyderabad. Developers at ISDL deliver technology in ...
📑 **Requisition number:** 2337681**Job category:** Technology **#OITech**Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care ...
📑 **Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
📑 **Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
📑 **Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
📑 **Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
📑 **Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
📑 **Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
📑 **About this role:** Wells Fargo is seeking a Senior Information Security Engineer. **In this role, you will:** + Lead or participate in computer security incident response activities for moderately complex events+ Conduct technical investigation of security related incidents and p ...
📑 **Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
📑 **Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
📑 **We help the world run better**At SAP, we keep it simple: you bring your best to us, and we'll bring out the best in you. We're builders touching over 20 industries and 80% of global commerce, and we need your unique talents to help shape what's next. The work is challenging – but it matters. You'll find a ...
📑 Job Description **About this role:** Wells Fargo is seeking a Software Engineer **In this role, you will:** + Participate in low to moderately complex initiatives and projects associated with the technology domain, including installation, upgrades, and deployment efforts+ ...
📑 **About this role:** Wells Fargo is seeking a Lead Information Security Engineer. **In this role, you will:** + Lead computer security incident response activities for highly complex events+ Conduct technical investigation of security related incidents and post incident digital for ...
📑 **Requisition number:** 2349022**Job category:** Technology Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benef ...
📑 **About Regeneron** Regeneron is founded on the belief that the right idea, combined with the right team, can lead to significant transformations. Our growing global network is dedicated to inventing, developing, and commercializing medicines that change lives for those with serious diseases. In doing s ...
📑 **Build our future together:** At Regeneron, we use science and innovation to develop life-changing medicines for people with serious diseases. We are seeking a Senior Specialist, Data Quality & Insights to join our Data Management team, supporting our clinical data operations in India in a hybrid work ...
📑 Who we are: Zinier's No-Code Customization field service automation platform empowers field service organizations with the combined power of humans and technology to keep our world up and running. No two field service organizations are alike… From the IT ecosystem you connect with, to th ...
📑 Lead Java Fullstack Developer About GlobalFoundries GlobalFoundries is a leading full-service semiconductor foundry providing a unique combination of design, development, and fabrication services to some of the world’s most inspired technology companies. With a global manufacturing fo ...
📑 Software Engineer Manager, Full Stack, Global Partnerships Studio _corporate_fare_ Google _place_ Hyderabad, Telangana, India **Advanced** Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep expertise in domain. **Minim ...
📑 Company: Manhattan Tech Ventures Pvt. Ltd. Location: Remote (India) Job Type: Full-time About the Role Manhattan Tech Ventures Pvt. Ltd. is looking for an experienced and highly skilled Senior Full Stack Developer with strong expertise in PHP, WordPress, React.js, Node.js, and TypeScript to lead the development, ...
📑 Company: Manhattan Tech Ventures Pvt. Ltd.Location: Remote (India)Job Type: Full-timeAbout the RoleManhattan Tech Ventures Pvt. Ltd. is looking for an experienced and highly skilled Senior Full ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,541,035+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Full-Stack AI Engineer / Technical... | Hamilton Bradshaw Group | Full-time |
| Full Stack Engineer Node.Js And... | Citigroup | Full-time |
| Full-Stack Ai Engineer / Technical... | Hamilton Bradshaw Group | Full-time |
| Senior Full Stack Engineer - Python... | Checkmate | Full time |
| SRE & DevOps Engineer (Full-stack... | N-iX | Full-time |
| Full Stack Developer (React JS Java... | Lancesoft Europe | Full-time |
| Full Stack Engineer (Ruby on Rails and React) | Accellor | Full-time |
| Full Stack Developer (PHP,... | Manhattan Tech Ventures | Full-time |
| Full Stack Developer (PHP,... | Manhattan Tech Ventures | Full-time |
| Full Stack Developer (PHP,... | Manhattan Tech Ventures | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!