1,661,095+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

APP03789 Lead Full Stack Developer | NP (Python + React Mandatory)

📑 Curated JD: Is this a pure play technical/techno functional role? - Technical role. Specific Contribution to the role: Designed and developed end-to-end full-stack applications using Python (Flask) and ReactJS, creating responsive UI solutions and scalable backend services while collaborating with Data Scientist ...

Java Full Stack Developer with AI/ML & AIDLC Skills

📑 Job DescriptionHiring Alert | Java Full Stack Developer with AI/ML & AIDLC Skills | WiproWe are hiring experienced professionals for an exciting opportunity with <span class= ...

Java Full Stack Developer with AI/ML & AIDLC Skills

📑 Job DescriptionHiring Alert | Java Full Stack Developer with AI/ML & AIDLC Skills | WiproWe are hiring experienced professionals for an exciting opportunity with <span class= ...

Full Stack Developer — SaaS Platform (Next.js / TypeScript / PostgreSQL) Remote

📑 About UsCarrier Compliance Services Inc. is a Canadian transportation safety and compliance consultancy serving ~40 carrier clients. We are building Steer Fleet TMS — a multi-tenant B2B SaaS platform that replaces manual compliance workflows for the trucking industry. ...

Full Stack Developer — SaaS Platform (Next.js / TypeScript / PostgreSQL) Remote

📑 About UsCarrier Compliance Services Inc. is a Canadian transportation safety and compliance consultancy serving ~40 carrier clients. We are building Steer Fleet TMS — a multi-tenant B2B SaaS platform that replaces manual compliance workflows for the trucking industry. The platform handles ...

Full Stack Developer — SaaS Platform (Next.js / TypeScript / PostgreSQL) Remote

📑 About UsCarrier Compliance Services Inc. is a Canadian transportation safety and compliance consultancy serving ~40 carrier clients. We are building Steer Fleet TMS — a multi-tenant B2B SaaS platform that replaces manual compliance workflows for the trucking industry. ...

Full Stack Developer — SaaS Platform (Next.js / TypeScript / PostgreSQL) Remote

📑 About UsCarrier Compliance Services Inc. is a Canadian transportation safety and compliance consultancy serving ~40 carrier clients. We are building Steer Fleet TMS — a multi-tenant B2B SaaS platform that replaces manual compliance workflows for the trucking industry. ...

Full Stack Developer — SaaS Platform (Next.js / TypeScript / PostgreSQL) Remote

📑 About Us Carrier Compliance Services Inc. is a Canadian transportation safety and compliance consultancy serving ~40 carrier clients. We are building Steer Fleet TMS — a multi-tenant B2B SaaS platform that replaces manual compliance workflows for the trucking industry. The platform hand ...

Full Stack Developer — SaaS Platform (Next.js / TypeScript / PostgreSQL) Remote

📑 About Us Carrier Compliance Services Inc. is a Canadian transportation safety and compliance consultancy serving ~40 carrier clients. We are building Steer Fleet TMS — a multi-tenant B2B SaaS platform that replaces manual compliance workflows for the trucking industr ...

Full Stack Developer — SaaS Platform (Next.js / TypeScript / PostgreSQL) Remote

📑 About Us Carrier Compliance Services Inc. is a Canadian transportation safety and compliance consultancy serving ~40 carrier clients. We are building Steer Fleet TMS — a multi-tenant B2B SaaS platform that replaces manual compliance workflows for the trucking industr ...

Full Stack Developer — Saas Platform (Next.Js / Typescript / Postgresql) Remote

📑 About UsCarrier Compliance Services Inc. is a Canadian transportation safety and compliance consultancy serving ~40 carrier clients. We are building Steer Fleet TMS — a multi-tenant B2B SaaS platform that replaces manual compliance workflows for the trucking industry. ...

Lead Software Engineer Full Stack Developer and Gen AI

📑 **About this role:** Wells Fargo is seeking a Lead Software Engineer **In this role, you will:** + Lead complex technology initiatives including those that are companywide with broad impact+ Act as a key participant in developing standards and companywide best practices for enginee ...

Full Stack Cloud Native Developer Digital Manufacturing (5 Years)

📑 **We help the world run better**At SAP, we keep it simple: you bring your best to us, and we'll bring out the best in you. We're builders touching over 20 industries and 80% of global commerce, and we need your unique talents to help shape what's next. The work is challenging – but it matters. You'll find a ...

Senior Director, Full Stack AI & Data Specialist (Rapid Prototyping)

📑 Ankura is a team of excellence founded on innovation and growth. Ankura is recognized as one of the five fastest growing consulting companies with over 2,000 employees across 32 offices in four continents, providing a range of advisory and expert services to the private and public sector.<br ...

Full Stack Engineer (Java/React), Aladdin Engineering, Vice President

📑 **About this role** **Job Description** Are you interested in building innovative technology that crafts financial markets? Do you like working at the speed of a startup, and solving some of the world’s most exciting challenges? Do you want to work with, and learn from, hands-on leaders in tech ...

Full Stack Software Engineer(React.js,Java) Assistant Vice President

📑 The Digital S/W Engineer Sr Analyst is a seasoned professional role. Applies in-depth disciplinary knowledge, contributing to the development of new techniques and the improvement of processes and workflow for the area or function. We are looking for experienced full-stack software engineers who are pas ...

Senior Engineering Manager (Full Stack, Security Domain |12+ Years)

📑 Cisco Cloud Security Engineering is building the next generation of cloud-delivered security services that help customers securely connect users, devices, applications, and networks from anywhere. As part of Cisco’s Security Business Group, our teams design, build, and operate the cloud-native services that powe ...

Full Stack Developer — SaaS Platform (Next.js / TypeScript / PostgreSQL) Remote

📑 About Us Carrier Compliance Services Inc. is a Canadian transportation safety and compliance consultancy serving ~40 carrier clients. We are building Steer Fleet TMS — a multi-tenant B2B SaaS platform that replaces manual compliance workflows for the trucking industry. The platform handles driver qualification f ...

Java Full Stack Developer with AI/ML & AIDLC Skills

📑 Hiring Alert | Java Full Stack Developer with AI/ML & AIDLC Skills | Wipro We are hiring experienced professionals for an exciting opportunity with Wipro. Position: Java Full Stack Developer Experience: 710 Years Location: PAN India Work Mode: Hybrid Max CTC: Up to 27 LPA Mandatory Skills: Strong experience in ...

Senior Engineer / Full stack Developer (SQL Focused, AI Enabled)

📑 Job DescriptionFull Stack Application DevelopmentDesign, develop, test, deploy, and maintain scalable web-based business applications using C#, ASP.NET, .NET Core, MVC, and modern web technologies.Translate business requirements and user stories ...

AI Software Engineer (Full Stack) | Senior Associate | Digital Solutions

📑 At PwC Australia, The future of Assurance is being built right now, and you could be one of the people building it. As a Software Engineer, you'll play a vital role in designing and developing cutting-edge digital products and AI-powered automation solutions that are transforming how Assurance services are de ...

Full Stack Cloud Native Developer Digital Manufacturing (5+Years)

📑 We help the world run betterAt SAP, we keep it simple: you bring you ...

Lead Software Engineer (.NET Full Stack and Azure / AWS)

📑 Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with mult ...

Member of Technical Staff (MTS) – Core Full Stack / Backend

📑 About UsWe are an AI-first engineering intelligence platform building the future of developer workflows completely from scratch. We are the core engineering team behind Fi, where we built and scaled fintech systems for over 3 million users. We don’t stitch together basic API wrappers; we work ...

Senior Software Engineer (.NET Full Stack and Azure / AWS)

📑 Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with mult ...

Lead Software Engineer (.NET Full Stack and Angular / React)

📑 Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with mult ...

Senior Software Engineer (.NET Full Stack and Angular / React)

📑 Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with mult ...

Manager, Software Engineer (Full Stack ReactJS, NodeJS, SQL) (copy)

📑 At Nielsen, we believe that career growth is a partnership. You ultimately own, fuel and set the journey. By joining our team of nearly 14,000 associates, you will become part of a community that will help you to succeed. We champion you because when you succeed, we do too. Embark on a new initiative, explore a ...

Lead Software Engineer (.NET Full Stack and Azure / AWS)

📑 Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with mult ...

Senior Software Engineer (.NET Full Stack and Azure / AWS)

📑 Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with mult ...

Lead Full Stack Engineer Java and React or Angular

📑 Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benefits, data and resources they need to feel their best. Here, you will fin ...

Lead Software Engineer (.NET Full Stack and Angular / React)

📑 Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with mult ...

Sr. Software Engineer, Java Full Stack Agentic ERP Platform

📑 About Rimini Street, Inc.Rimini Street, Inc. (Nasdaq: RMNI), a Russell 2000® Company, is a proven, trusted global provider of end-to-end, mission-critical enterprise software support, managed services and innovative Agentic AI ERP solutions, and is the leading third-party support provider for Or ...

FBS Agile Dev Team Member III .NET Full Stack

📑 Participate in the coding, testing, and debugging of Optimizely CMS websites to ensure they meet specified requirements and quality standards. Apply best practices in web development, including coding standards, code reviews, source control management, build processes, and testing. Optimize web applications f ...

Lead Software Engineer (.NET Full Stack and Angular / React)

📑 Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with mult ...

Lead Software Engineer (.NET Full Stack and Angular / React)

📑 Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with mult ...

Senior Full Stack Engineer – AI Embedded Quality Engineering Platform

📑 Lab49 is building a next-generation AI-embedded Quality Engineering Platform for a leading financial services institution. This greenfield role focuses on building a full-stack, AI-native SDLC/STLC platform from scratch, combining application development, AI-driven workflows, and continuous testing capabilities ...

Quation Solution Full stack Developer (Python, Django + React /Angular)

📑 Company : Quation Solutions Job Title: Full Stack Developer Location: BangaloreWork Model: Hybrid (2 days from office)Experience: 3 to 6 YearsInterview Process: 2 Technical Round ...

Senior Software Engineer (.NET Full Stack and Azure / AWS)

📑 Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with mult ...

Full stack Developer 1 for Ongoing production Support Team

📑 Our storyAt Alight, we believe a company’s success starts with its people. At our core, we Champion People, help our colleagues Grow with Purpose and true to our name we encourage colleagues to “Be Alight.”Our Values:Champion People – be empathetic and help create a place wh ...

Senior Software Engineer (.NET Full Stack and Angular / React)

📑 Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with mult ...

Java Full Stack Developer(3 Months Contract_Work from office)

📑 Experience - 2-5 Years  Work Location- Gurugram(3 Months contractual) About the RoleWe are looking for a highly skilled Full Stack Engineer with strong expertise in Java Spring Boot for backend develop ...

Full Stack Engineer (Data & Backend focused ) (Indian Citizen only)

📑 Please note We need someone who is physically present in India.Full Stack Engineer - IICompany: CODVO.AIDepartment: EngineeringLocation: Work From Home (India)<str ...

Lead Software Engineer (.NET Full Stack and Azure / AWS)

📑 Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with mult ...

Senior Software Engineer (.NET core full stack Angular 19)

📑 Job DescriptionPOSITION TITLE : Senior Software EngineerREPORTING LOCATION: Bangalore, IndiaCORE OBJECTIVE: Deliver and maintain high quality software by oneself and together, within a team, including analysis, design, code, testing, documentation, operation, support ...

Lead Software Engineer (.NET Full Stack and Azure / AWS)

📑 Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with mult ...

Full stack Developer 2 for Ongoing production Support Team

📑 Our storyAt Alight, we believe a company’s success starts with its people. At our core, we Champion People, help our colleagues Grow with Purpose and true to our name we encourage colleagues to “Be Alight.”Our Values:Champion People – be empathetic and help create a p ...

Senior Full Stack Engineer (.NET / Cloud / Data / AI Integration)

📑 Job Description Job SummaryWe are seeking a highly skilled Senior Full Stack Engineer with strong experience in .NET, SQL, cloud platforms, and AI integration to help evolve our applications with intelligent, data-driven capabilities.This role ...

Senior Software Engineer Java Full Stack Developer with FICO

📑 Position Description: At CGI, we’re a team of builders. We call our employees members because all who join CGI are building their own company - one that has grown to 72, professionals located in 40 countries. Founded in , CGI is a leading IT and business process services firm committ ...

DE AWS Cloud Native Full Stack Engineer BMO GDSF02

📑 At EY, you’ll have the chance to build a career as unique as you are, with the global scale, support, inclusive culture and technology to become the best version of you. And we’re counting on your unique voice and perspective to help EY become even better, too. Join us and build an exceptional experience for ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,661,095+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
APP03789- Lead - Full Stack... ObjectWin Technology India Pvt. Ltd Full-time
Java Full Stack Developer with AI/ML... Vrinda International Full-time
Java Full Stack Developer with AI/ML... Vrinda International Full-time
Full-Stack Developer — SaaS Platform... Carrier Compliance Services Inc. Full-time
Full-Stack Developer — SaaS Platform... Carrier Compliance Services Inc. Full-time
Full-Stack Developer — SaaS Platform... Carrier Compliance Services Inc. Full-time
Full-Stack Developer — SaaS Platform... Carrier Compliance Services Inc. Full-time
Full-Stack Developer — SaaS Platform... Carrier Compliance Services Inc. Full-time
Full-Stack Developer — SaaS Platform... Carrier Compliance Services Inc. Full-time
Full-Stack Developer — SaaS Platform... Carrier Compliance Services Inc. Full-time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!