1,494,309+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

Professional job seekers finding India jobs through Expertini
750,000+ professionals on Expertini 750,000+ Candidates
Join our global community
Expertini Penguin Mascot Resume Score™
Resume Score™ Instantly
Upload Your CV
Quick 30-second process

Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.

Reset

Create Job Alert

 
   
Reset

Full Stack Developer Dehradun

Cynet Corp is looking for a talented Full Stack Developer to join our dynamic team in Dehradun. In this role, you will be involved in designing, developing, and maintaining scalable web applications and services that are integral to our innovative projects. Your Responsibilities: Develop ...

Full Stack Development Web

Roles & Responsibilities:-Operating a Hybrid Cloud with Microsoft Azure Stack? – Certified  Lead and inspire a team of Backend Engineers in the Europe & India to deliver world class services  Help product teams to develop and deploy on a cloud native environment  Ensure all key service ...

Engineersmind Full Stack Developer

Company- EngineersMind Role- FSD Location- Bangalore Work Mode- 5 Days Onsite Experience- 4-8 Years Role Overview Backend / Full Stack Developer ...

Senior Full Stack Engineer

Job DescriptionThe Senior Full Stack Engineer is a highly skilled individual contributor who builds high-quality software while contributing to technical direction within the team. This is a hands-on role focused on delivering scalable, maintainable solutions while supporting a culture of continuous ...

Senior Full Stack Developer

Hybrid, Pune, 5+ Years Position 3 Budget : Open Client : UBS BANK Were looking for someone like that who can: * Design and implement microservices architectural. * Develop and maintain server-side logic ...

Software Architect Full stack

Job Role and Responsibilities Experience in a Software Architect role Considerable experience in software development and programming with different languages (e.g., Python, .NET, Java) Extensive experience with UML and various modeling techniques Comprehensive understandi ...

Lead Full Stack Developer

Why This Role Exists We don’t need a typical developer. We need someone who can translate business goals into scalable systems, lead technical execution, and drive the development of a high-performing AI-powered SaaS platform . This role sits at the ce ...

Senior Full Stack Engineer

Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benefits, data and resources they need to feel their best. Here, you will fin ...

Full Stack / SharePoint Developer

Full Stack / SharePoint Developer Based in Mulgrave Opportunity for growth in an expanding IT team Due to our client's growth and expansion of their IT team and we are looking for a motivated ...

Senior Full Stack Developer

Job Description Job Title - Sr. Software Developer <ul no-style=margin:10px 0px 10px 20px; padding:0px 0px 0px 5px; list-style:outside none none; background-image:none; color:rgb(49, 57, 73); font-family:PuviMedium; font-size:14px; font-style:normal; font-weight:400; letter-spacin ...

Full Stack Technical Lead

About Us: We are a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...

Full Stack Engineering Manager

Full Stack Engineering Manager Bangalore, India | R&D Share position At JFrog, we're reinventing DevOps to help the world's greatest companies innovate – and we want you along for the ride. This is a special place with a unique combination of brilliance, spirit and just all-around grea ...

.NET Full stack developer

• 10+ years in development Software solutions • Expert working knowledge of C# and .Net • Expert database skills within any RDBMS systems, primarily SQL Server • Experience in web development, mostly with SPA frameworks angular and angular JS, JavaScript, NBC, soap/rest web services • Financi ...

Java Full Stack Developer

Greetings from Colan Infotech !!! Role - Java Fullstack Developer Experience - 4+ Years Job Location - Chennai / Bangalore Notice Period - Immediate to 15 Days only S ...

Full Stack Engineer III

What this Job Entails: We are seeking an experienced Full Stack Engineer with a minimum of 5 yearsof expertise in Core Java development on a Cloud environment. The idealcandidate should possess a deep understanding of full-stack developmentusing Java, REST APIs, and Containeriza ...

Consultant – Full Stack Developer

Genpact (NYSE: G) is a global professional services and solutions firm delivering outcomes that shape the future. Our 125,000+ people across 30+ countries are driven by our innate curiosity, entrepreneurial agility, and desire to create lasting value for clients. We dream in digital, dare, and reinvent the wa ...

Full Stack Engineer III

What this Job Entails: We are seeking an experienced Full Stack Engineer with a minimum of 5 yearsof expertise in Core Java development on a Cloud environment. The idealcandidate should possess a deep understanding of full-stack developmentusing Java, REST APIs, and Containeriza ...

Java Full Stack Developer

Java Full Stack Developer Full Time Job Code: T-82117 | India 20 positions Required Experience 3 - 10 Years Skills Java Fullstack Developer Job Description 3+ years of hands-on applicatio ...

full stack ReactNode JS

full stack-ReactNode JS - CREQ Description Development and implementation of web applications using ReactJS, NodeJS (with NestJS or ExpressJS), and TypeScript/JavaScript. Design, optimize, and manage PostgreSQL databases, including schema design and data migration/transformation. Implement best practi ...

Full Stack Web Developer

Overview The Full Stack Web Developer will employ React and Node.js in an embedded and cloud environment to bridge our Q-SYS platform to the connected world. Q-SYS is a fast growing, award winning, software and hardware platform encompassing cutting-edge audio, video and contr ...

Developer, FUSE Full Stack

Do you want to help solve the world's most pressing challenges? Feeding the world's growing population and slowing climate change are two of the world's greatest challenges. AGCO is a part of the solution! Join us to make your contribution. AGCO is looking to hire candidates for ...

Full Stack Web Developer

We are HRTech startup (questo.in) which offers best analytics to recruiters and companies to find the best talent faster. At Questo we are building some amazing products to change the way company and recruiters find and connect to the premium talents. We are doing some disruptive innovation while working on t ...

Sr. Full Stack Developer

Main Purpose: Puma Energy is seeking a Full Stack Developer to join its Digital & Technology team, supporting the design, development, and operation of its core digital platform across multiple African markets. The platform handles high-volume transactional operations spanning mobile applicatio ...

Lead Full Stack Developer

CDM Smith is seeking a Full Stack Application Developer to join our Digital Engineering Solutions team. This individual will be part of the Development group within the Digital Engineering Solutions team, helping design and implementation of cloud-based solutions facilitating CI/CD practices, and ...

java Full Stack Developer

java Full Stack Developer - CREQ Description Full Stack Developer Resource should be having 3 years of knowledge or experience working in Banking Domain Should have strong understanding of SDLC Must have excellent analytical Skills Good knowledge of Angular, Java, Oracle SQL Must have ...

Full Stack Developer Vertoz

Job Description What we want: Seeking a Full-Stack Developer Fresher with basic knowledge of Node.js, React.js, MySQL/PostgreSQL, and Microservices Architecture. The ideal candidate should be enthusiastic about web development, eager to learn, and ready to contribute to ...

Remote Full Stack Developer

We are seeking a highly skilled Full-Stack Developer to join our dynamic and growing team. If you're passionate about the latest web technologies and have a keen eye for detail, then we want to hear from you. Responsibilities: Design and development of robust, s ...

Java Full Stack Trainer

We need trainers with developer mind set who has a passion to teach and mentor Experience to build live web applications with frontend, backend and database Preparing the right curriculum and content to deliver necessary training Evaluate student performance and resolve their queries Ability to explore and learn ...

Full Stack Developer Product

Skills Strong proficiency in JavaScript, including DOM manipulation and the JavaScript object model. Expertise in backend programming with Node.js and MongoDB. Experience with React.js and redux. Material UI and 3rd party libraries. Experience with clean cod ...

Full stack Engineer(Python)

Candidate should be able to: • Provide technical mentorship and ensure that code is developed to standards. Lead Code reviews. • Develop Project Scope Documentation to include deliverables, timelines, and budget. Work with the Project Manager and Business stakeholders to develop the desired solution. ...

Java Full Stack Developer

Job Title : Java Full Stack Developer Experience : 3 to 5 Years Work Mode : Remote Notice Period : Immediate Joiners Preferred Job Description: We ar ...

Full Stack Developer (C#).

Full Stack Developer (C#)The Treasury Technology team at Millennium is responsible for developing and supporting wide range of software product and services across Treasury ecosystems. In this role, you will work on sophisticated software systems that support our firm’s liquidity management and financing stra ...

Engineering Manager Full Stack

Role: Full Stack Developer Experience: 8+ years Location: Chennai Immediate to 30 days We are seeking an experienced Full Stack Developer with 8+ years of ...

React Full stack Engineer

React Full-stack EngineerReact, C#, .NET, REST API Development, Azure Resources, SQL & NoSQLEnglish Communication, Unit Testing, Travel Ecosystem Knowledge (Plus)Senior 10+ Years ...

Lead Full Stack Engineer

About Us: We are a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, w ...

Lead Full Stack Engineer

About Us: We ae a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...

.NET Full stack developer

• 10+ years in development Software solutions • Expert working knowledge of C# and .Net • Expert database skills within any RDBMS systems, primarily SQL Server • Experience in web development, mostly with SPA frameworks angular and angular JS, JavaScript, NBC, soap/rest web services • Financi ...

Full Stack Developer Advisor

Responsible for leading and mentoring development teams, collaborating on requirements, architecting and implementing scalable microservices, ensuring code quality and security, troubleshooting and testing solutions, managing priorities, overseeing demo content, facilitating cross-team communication, coordina ...

Full Stack .Net associate

Possesses a solid understanding of object-oriented programming concepts, ideally with proven knowledge of Visual Studio, the .NET Framework, C#, VB, MVC, SQL Server, Javascript, Jquery, and IIS. • A plus to have experience with client-side frameworks such as ReactJS and Angular. • An understanding of ...

Sr. Full Stack Developer

About this opportunity As a Sr. Full Stack Developer, you will work with a cross-functional agile team. Support existed and create new functionality from scratch, participate in architecture discussions, develop web applications following the up-to-date web standards, APIs and integration ...

.Net Full Stack Development

Strong experience in .NET development , including Azure Functions and Console Applications . Proficiency in Angular (latest versions) for developing modern, responsive web applications. Experience designing and developing RESTful Services/APIs . < ...

Full Stack Java Developer

Job Summary Synechron is seeking an experienced Java Full Stack Developer to craft scalable, secure, and high-performance enterprise applications. This role involves designing and developing robust back-end services with Java frameworks like Spring and Hibernate, alongside creating engaging front- ...

Technical Lead (Full Stack)

We are looking for an experienced Technical Lead with 10+ years of full-stack development expertise in Java (Spring Boot) and Node.js to drive the design and delivery of scalable, high-performance applications in the banking domain. The ideal candid ...

Full Stack Developer Intern

About the Role We are looking for enthusiastic and curious Full Stack Developer Interns who are excited to build real-world web applications that create meaningful impact in the education sector. As an intern, you will work closely with experienced ...

Lead Full Stack Developer

About Us: We are a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...

Full Stack Technical Lead

About Us: We are a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, we ...

Senior Full Stack Developer

Job Title Senior Full Stack Developer Location (s) Cochin Years of Experience 8-10 years Job Description 1. Lead and manage technical projects from inception to completion. 2. Full stack java developer with hands-on experience developing web application ...

Full Stack Developer Lead

• 4-6 years of proven IT Experience • Full-Stack Development Expertise • Minimum, one year Javascript, proven Experience • Excellent in Java Springboot JavaScript and OOP JavaScript TypeScript ES6 • Proficient in web development • Java Springboot HTML CSS JavaScript Typescript • Sol ...

.Net Full stack Lead

Job Title: .Net Full stack Lead – (.NET Core, ReactJS, Azure) Experience Required: 7–12 YearsLocation: Hyderabad Role Overview We are seeking a highly skilled and experienced Technical Lead </str ...

Java Full Stack Engineer

Let’s be #BrilliantTogether ISS STOXX is growing! ISS STOXX is looking for a Java Full Stack Developerto join ourteam in Mumbai, India. Overview: At ISS-Stoxx, we believe in purpose, mastery, and autonomy . Our mission is to empower shareholders around the world to mak ...

🚀 Boost Your Hiring Chances with Our AI-Powered Tool-Kit

Stand out from thousands of applicants. Use our proven career tools to optimize your applications and land your dream job faster.

To-Do Planner

Organize your job search and personal tasks. All data is confidential.

Open Planner

Wellbeing Center

Access your confidential wellness report and resources to manage job search stress.

Check Wellbeing

Skill Coach

Plan your skill development with O*NET support to stay competitive in your field.

Start Coaching

Outfit Helper

Get AI-powered suggestions on what to wear for your next interview.

Find Outfit

Income Tax Calculator

Plan your finances with our calculator, updated for 2025 tax regulations.

Calculate Tax

Salary Benchmark

Get accurate, AI-supported salary trends to know your worth and negotiate better.

Check Salaries

Interview Practice

Practice for any interview with AI-enabled Q&A sessions. All data is private.

Start Practicing

Interview Predictor

Use our AI-supported tool to predict potential interview questions based on your resume.

Predict Questions

Interview Practice Timer

Use our mock interview trainer to perfect your answers under timed conditions.

Start Timer

Behavioral Mastery

Ace tricky behavioral interviews with our AI-powered practice module.

Master Answers

Question Journal

Confidentially record interview questions you were asked for future reference.

Open Journal

Interview Ace

A comprehensive tool to help you master every aspect of your interviews.

Become an Ace

Q&A Logs

Confidentially track your answers to common questions and refine them over time.

View Logs

Application Planner

Schedule and organize your job applications in one confidential planner.

Open Planner

Cover Letter Tool

Create perfect, tailored cover letters for each application with AI support.

Generate Letter

Resume Score

Get instant feedback on your resume with our NLP-supported analysis tool.

Check My Score

ATS Score

Check your resume's compatibility with Applicant Tracking Systems (ATS).

Check ATS Score

Application Analyzer

Use AI to analyze job descriptions and optimize your application materials.

Analyze Application

Career Visualizer

Confidentially plan and visualize your long-term career path and goals.

Visualize My Career

Offer Genius

Get intelligent insights and strategies to confidently negotiate job offers.

Negotiate Offers

JobFlow

Track your entire job search progress from application to offer with this intelligent tool.

Track My Flow

JobSense

Our intelligent matching engine that provides smart job recommendations.

Get Smart Matches

Networking Toolkit

Tools to build and manage your professional connections. All data is confidential.

Build Network

Professional CV

A classic, O*NET supported template for corporate and professional roles.

Use This Template

Executive CV

A premium, O*NET supported template designed for senior and C-level positions.

Use This Template

Modern CV

A fresh, stylish, O*NET supported template perfect for tech and modern industries.

Use This Template

Creative CV

A visually distinct, O*NET supported template for design and artistic roles.

Use This Template

Minimalist CV

A clean, simple, O*NET supported template that focuses purely on content.

Use This Template

Europass CV

The standard European Union recommended format for wide compatibility.

Use This Template

Student CV

An institution-recommended template perfect for internships and first jobs.

Use This Template

Graduate CV

An institution-recommended template for recent graduates entering the workforce.

Use This Template

Academic CV

The researcher-recommended format for roles in academia and research.

Use This Template

Developer/IT CV

A tech-savvy recommended template to highlight your technical skills.

Use This Template

Skilled Worker CV

A trades-recommended template to showcase hands-on skills and experience.

Use This Template

Monochrome CV

A sleek, black-and-white, O*NET supported template for a professional look.

Use This Template

Art CV

An artist-recommended template that allows your creativity to shine.

Use This Template

Harvard CV

A researcher-recommended template based on the classic Harvard format.

Use This Template

Volunteer Research

Help us improve our platform by joining our community research program.

Join Research

Review Us

Share your experience with our tools to help other job seekers.

Share Experience

Register

Create your free account to save jobs, build your profile, and track applications.

Create Account

Login

Access your dashboard, manage applications, and continue your job search.

Access Your Account

Profile Builder

Create a comprehensive professional profile that attracts recruiters and showcases your skills.

Build Your Profile

View Profile

See your public profile exactly as employers will see it. Make sure it's perfect.

Preview Profile

Bookmarked Jobs

Keep track of all your saved job opportunities in one organized place.

View Saved Jobs

Your Reviews

View and manage all the company reviews you've submitted.

See Your Reviews

Following

Manage the list of companies you follow to stay updated on their new openings.

Manage Following

Find Companies

Discover and research top employers in your country and industry.

Discover Employers

Standalone CV Builder

Use our O*NET supported CV builder to create a professional resume from scratch.

Build Your CV

PDF to DOC (Beta)

Convert your PDF resumes or documents into editable Word (DOC) format.

Convert PDF

DOC to PDF (Beta)

Create universally compatible PDF documents from your Word (DOC) files.

Create PDF

General FAQ

Find answers to common questions about our job site and platform.

Read FAQ

Job Seekers FAQ

Get help and find answers to questions specifically for job seekers.

Get Help

Job Matching

Learn about the technology and algorithms behind how we match you to jobs.

Learn How

Personalized Matching

Discover how we use your profile and activity to provide customized job suggestions.

Learn More

Quick Apply

Understand our fast application process and how to make the most of it.

Learn More

Alert Frequency

Learn how to manage your job alert settings so you get the updates you want.

Manage Settings

Job Alerts Guide

A complete guide to understanding how job alerts work and how to use them effectively.

Read Guide

Resume Matching

Learn how our system matches your resume to job requirements.

Learn More

Ethical Branding

Read our guide to building a professional and ethical personal brand.

Read Guide

Candidate Visibility

Learn how to increase your visibility to recruiters on our platform.

Increase Visibility

Verified Badge

Find out how you can get a verified badge to build trust with employers.

Get Verified

AI ATS Technology

Learn about the advanced AI and ATS technology that powers our platform.

Learn More

ATS Ranking

Understand how Applicant Tracking Systems rank you as an applicant.

Learn More

Semantic Matching

Learn how our AI-powered semantic matching goes beyond keywords.

Learn More

    Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights