• India Jobs Expertini profile avatar

    • 1,494,418+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

    Professional job seekers finding India jobs through Expertini
    750,000+ professionals on Expertini 750,000+ Candidates
    Join our global community
    Explore Leading Employers
    High-Paying Careers
    Expertini Penguin Mascot Resume Score™
    Resume Score™ Instantly
    Upload Your CV
    Quick 30-second process

    Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.

    1. Expertini
    2. India
    3. Jobs
    4. Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India

    5. Download PDF

    Reset

    Create Job Alert
      Add Alert

     
     
    Create Alert
     
    Reset

    Sr Consultant Full Stack Developer

    Job Description Description The hiring manager would like the consultants co-located together in same city / building to support each other. ‌ ** The keys to this requirement are backend Java, Spring Boot (Spring IO , Spring MVC), ...

    Senior Developer ReactJS Full stack

    Location: Bangalore out ring road, 3 days mandatory work from office at client location Experience Range 6 - 10 Years Job Type: 6 months contract + ext Need Immediate joiners only <stro ...

    Senior Software Engineer Full Stack

    Great vacancy Senior Software Engineer hiring now <meta content=AoeiQ3Ow/BnNjoZ1k2kL0ix9SXzlnjm47YFisfuVAskKVTny0NGo4CEkVQNe1OCi48F77X4EZc6G69wDDJtAlggAAABleyJvcmlnaW4iOiJodHRwczovL3NhbGVzZm9yY2Utc2l0ZXMuY29tOjQ0MyIsImZ ...

    Beacon.li Senior Full Stack Engineer

    Job Description: SDE3 / Principal Engineer Location: On-Site Hyderabad About the Role:We are seeking a highly skilled SDE3 / Principal Engineer to join our dynamic engineering team. This is not a role for someo ...

    Atlassian Full Stack Forge Developer

    Are you ready to power the future? At SolarEdge (NASDAQ: SEDG), we're a global leader in smart energy technology, with over 4,000 employees, offices in 34 countries, and millions of installations worldwide. Our innovative solutions include solar inverters, battery storage, ba ...

    Software Engineer Full Stack Java

    Who We Are At Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ...

    Java Full Stack(Angular) Developer

    Summary The Senior Java/Angular Developer participates in the full development life cycle of business software including design, development, unit/load testing, deployment and maintenance of a software system and implementation of business software for the enterprise. Provides e ...

    Senior Full Stack Developer MERN

    Requirement Details are below: Title: Senior Full Stack Developer Banking Domain Location: Thousand Lights, Chennai Work Mode: Onsite (5 Days) | Sat/Sun Week Off Department: Software Development Positions: 1 Employment Type: Full Time Remote: No </ ...

    LEAD ENGINEER FULL STACK DEV

    JD for Full-Stack / Back-End Developer Go Language About the Role We are looking for an experienced Go (Golang) Developer with 7 10 years of experience, capable of contributing either as a strong back-end engineer or as a full stack developer. The ideal candidate should have deep hands-on ...

    Principal Consultant Full stack Python

    Ready to build the future with AI? At Genpact, we don’t just keep up with technology—we set the pace. AI and digital innovation are redefining industries, and we’re leading the charge. Genpact’s AI Gigafactory, our industry-first accelerator, is an example of how we’re scaling advanced technology solu ...

    Senior Full Stack Engineer AI

    ZoomInfo is where careers accelerate. We move fast, think boldly, and empower you to do the best work of your life. You’ll be surrounded by teammates who care deeply, challenge each other, and celebrate wins. With tools that amplify your impact and a culture that backs your ambition, you won’t just contribute ...

    Tech Lead Full Stack Job

    YASH Technologies is a leading technology integrator specializing in helping clients reimagine operating models, enhance competitiveness, optimize costs, foster exceptional stakeholder experiences, and drive business transformation. At YASH, we’re a cluster of the brightest stars working with cutting- ...

    Principal Engineer Java Full Stack

    HARMAN’s engineers and designers are creative, purposeful and agile. As part of this team, you’ll combine your technical expertise with innovative ideas to help drive cutting-edge solutions in the car, enterprise and connected ecosystem. Every day, you will push the boundaries of creative design, and HA ...

    Lead Consultant, Full stack Developer

    Ready to shape the future of work? At Genpact, we don’t just adapt to change—we drive it. AI and digital innovation are redefining industries, and we’re leading the charge. Genpact’s AI Gigafactory, our industry-first accelerator, is an example of how we’re scaling advanced technology solutions to he ...

    Quick Interview , Full stack Analys...

    • 2+ years’ experience in one of the following Cloud technologies: AWS, Azure, Google, OpenStack • 1+ years’ experience with one of the following Agile methodologies: Scrum, SAFe, and Kanban • 2+ Years’ experience in one of the following Quality Assurance technologies: ATDD, Selenium, Cucumber, JUnit, ...

    Senior Full Stack Developer (CORE)

    We are looking for an experienced Senior Full Stack Developer who can handle both front-end and back-end development, contribute to API integrations, and mentor junior developers. This is a fully remote position. Job Responsibilities Build and maintain scalable web applic ...

    Quation Full Stack Web Developer

    Designation: Associate Product Architect Full Stack Developer Job Location: Bangalore Experience - 5+ Years Skills - Python, React/ Angualr Essential Functions • Continuous delivery of high-quality code for strategic t ...

    Software Engineer Full Stack Java

    Who We Are At Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ...

    Technical Lead Java Full Stack

    Technical Lead - Java Full Stack IT (Information Technology) Permanent contract Bangalore, India Hybrid Reference IB Start date Immediately Publication date 2025/06/14 Responsibilities Profile Required Responsibilities Responsible for understa ...

    Full Stack Gen AI Developer

    We are looking for a Staff Software Engineer who will design and build scalable full-stack software systems that deliver measurable business value. You will work directly with teams across Commercial, Manufacturing, and R&D to discover problems, navigate ambiguity, a ...

    Senior Design Engineer Full Stack

    About the Role We are seeking a highly skilled Senior Full Stack Developer who can design, develop, and deliver high‑quality software solutions across the full technology stack. This role requires strong technical expertise, problem-solving skills, and the ability to work collaboratively with cross-functional te ...

    .Net Angular Full Stack developer

    Our story At Alight, we believe a company’s success starts with its people. At our core, we Champion People, help our colleagues Grow with Purpose and true to our name we encourage colleagues to “Be Alight.” Our Values: Champion People – be empathetic and help crea ...

    Senior Full Stack Developer (Node.js)

    Senior Full Stack Developer (Node.js) ENO8 is a Dallas-based tech studio that empowers companies to design and develop innovative, impactful digital products. We are currently hiring an experienced Senior Full Stack Developer for a full-time, fully remote role based out of India . About the Jo ...

    .NET Full Stack Web engineer

    • Progressive web app using Angular, HTML, CSS, JavaScript, and MVC/MVVM design patterns • Strong understanding of APIs (resource/queryable) and Web Services: RESTful API • DevOps team environment development management to include Repository management (git), code reviews, pull requests, branching/rele ...

    Senior Full Stack Developer (GraphQL)

    Join our high-performing team as a Senior Full Stack GraphQL Developer. You'll build next-generation web applications using GraphQL, React.js, NEST.js, Express.js, and Azure Cloud. In this role, you'll develop scalable, robust solutions and drive exceptional, user-centric experiences in a collaborative, fast-pac ...

    Principal Engineer Java Full Stack

    HARMAN’s engineers and designers are creative, purposeful and agile. As part of this team, you’ll combine your technical expertise with innovative ideas to help drive cutting-edge solutions in the car, enterprise and connected ecosystem. Every day, you will push the boundaries of creative design, and HA ...

    Senior Technical Lead(Full Stack)

    About Taglynk At Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world ...

    Sr. Full Stack Developer(node.js)

    Candidate should be able to: Design and develop microservices using node.js. Participate in agile development processes in SDLC, including sprint planning, iterative development, estimations, and design sessions Communicate effectively across desks, teams, and departments Develop clean, mo ...

    Full Stack Java Software Engineer

    • 4-6 years of proven IT Experience • Full-Stack Development Expertise • Minimum, one year Javascript, proven Experience • Excellent in Java Springboot JavaScript and OOP JavaScript TypeScript ES6 • Proficient in web development • Java Springboot HTML CSS JavaScript Typescript • Sol ...

    PrimeSoft .NET + Angular Full stack

    Company: PrimeSoft Role : Senior Software Engineer (.NET + Angular Full stack) Responsibilities: Participate in the design and development of tools and technologies for integrating, processing, and visu ...

    Full Stack Developer Creative Automation

    The purpose of this role is to develop required software features, achieving timely delivery in compliance with the performance and quality standards of the company.Job Description: Responsibilities: Develop and implement custom workflows for creative production and automation u ...

    Lead Java Full Stack Developer

    Candidate should be able to: Ensure quality by performing thorough testing and leveraging peer reviews for your work and the work of cross-functional teams Implement excellent end-user experiences, continually raising the bar on functionality, usability, and simplicity Drive robust, maintainable, ...

    Full Stack Developer Creative Automation

    The purpose of this role is to develop required software features, achieving timely delivery in compliance with the performance and quality standards of the company.Job Description: Responsibilities: Develop and implement custom workflows for creative production and automation u ...

    Full Stack Angular/NodeJS Developer

    Job Description The primary goal of this role is to utilize advanced software engineering skills to oversee the entire lifecycle of our software products and services—from planning and design to deployment, support, and maintenance. This role requires the ability to independently manag ...

    Full Stack Developer – Cloud Applications

    Company Overview: Schneider Electric is a global leader in energy management and automation, committed to providing innovative solutions that ensure Life Is On everywhere, for everyone, and at every moment. We are expanding our team in Gurugram and looking for a full stack developer to enhance our cloud capabili ...

    Staff Engineer, Full Stack UI

    About Netskope Today, there's more data and users outside the enterprise than inside, causing the network perimeter as we know it to dissolve. We realized a new perimeter was needed, one that is built in the cloud and follows and protects data wherever it goes, so we started Net ...

    Lead Java Full stack Developer

    Candidate should be able to: Ensure quality by performing thorough testing and leveraging peer reviews for your work and the work of cross-functional teams Implement excellent end-user experiences, continually raising the bar on functionality, usability, and simplicity Drive robust, maintainable, ...

    Full Stack Software Engineer GenAI

    We are seeking a Full Stack Software Engineer with strong expertise in Node.js, React.js, and Generative AI integrations . You will be responsible for building scalable digital products and embedding AI-driven capabilities into applications. Key Responsibili ...

    Java Full Stack Mid Level

    Position Description: Company Profile:Founded in , CGI is among the largest independent IT and business consulting services firms in the world. With 94, consultants and professionals across the globe, CGI delivers an end-to-end portfolio of capabilities, from strategic IT and ...

    Angular, Java Full Stack Architect

    Principal Software Engineer The Dell Security & Resiliency organization manages security risks across all aspects of Dell's business. With team members located in over 15 countries, you will have an excellent opportunity to influence the security culture at Dell and further develop your career. ...

    Angular, Java Full Stack Architect

    Principal Software Engineer The Dell Security & Resiliency organization manages security risks across all aspects of Dell's business.With team members located in over 15 countries, you will have an excellent opportunity to influence the security culture at Dell and further develop your career. ...

    Sr. Software Engineer Full Stack

    {railsEnv:production,inMailer:false,i18nLocale:en,i18nDefaultLocale:en,rorVersion:13.0.2,rorPro:false,href: {htmlString:u003cdivu003e u003c!--block--u003eu003cstrongu003eJob Title: Sr. Software Engineer u003cbru003eLocation: Remote u003cbru003e u003c/strongu003eu003cbru003 ...

    Java Full Stack Vice President

    Engineering Lead You should be required to be proficient in Java/J2EE tech stack. Must have expertise in Agile Software development methodology. Good hands-on designing and development using SOLID Design principles. Exposure to new age tech-stack lik ...

    Senior Full Stack Developer (GraphQL)

    Join our high-performing team as a Senior Full Stack GraphQL Developer. You'll build next-generation web applications using GraphQL, React.js, NEST.js, Express.js, and Azure Cloud. In this role, you'll develop scalable, robust solutions and drive exceptional, user-centric experiences in a collaborative, fast-pac ...

    Full Stack Developer (Night Shift)

    About Reveal HealthTech Reveal Healthtech is a healthcare and life sciences focused data, AI and engineering services company head- quartered in New York with offices in San Francisco and Bangalore, India. Reveal was founded in February 2023 by Sanchit Mullick(Founder ...

    Senior Java Developer (Full Stack)

    Description :About the Role We're seeking a Senior Java Developer with 5+ years' experience to build high-performing, scalable enterprise portal backends, APIs, and modern React frontends. You'll develop modular services, cloud-native integrations, and headless APIs for ...

    Full Stack Engineer Python+React

    Job Summary: As a Full Stack Engineer, you’ll be responsible for developing and maintaining modern web applications using Python (FastAPI) on the backend and React.js on the frontend. You’ll work closely with designers, engineers, and product stakeh ...

    Full Stack Developer MEAN/MERN

    Requirements: 2-4 years experience developing with MEAN / MERN stack. Should have experience in agile methodology. Own and drive business features into tech requirements. Design & develop full stack modules and components. Hands on in end to ...

    Full Stack Developer (Outbound/Selfservice)

    Job DescriptionWe are seeking a Full Stack Developer to build a configurable, UI-driven self-service platform for contact center operations on top of Amazon Connect. The platform enables business users to manage call routing, queues, and outbound campaigns without requiring code changes or developer ...

    ShimentoX Technologies Full Stack Developer

    Full Stack Developer Job Location: Hyderabad Work Mode: 5 days Onsite Java, Spring Boot, Angular or ReactJS, AWS or Azure Cloud, REST APIsJavaScript / ...

    🚀 Boost Your Hiring Chances with Our AI-Powered Tool-Kit

    Stand out from thousands of applicants. Use our proven career tools to optimize your applications and land your dream job faster.

    To-Do Planner

    Organize your job search and personal tasks. All data is confidential.

    Open Planner →

    Wellbeing Center

    Access your confidential wellness report and resources to manage job search stress.

    Check Wellbeing →

    Skill Coach

    Plan your skill development with O*NET support to stay competitive in your field.

    Start Coaching →

    Outfit Helper

    Get AI-powered suggestions on what to wear for your next interview.

    Find Outfit →

    Income Tax Calculator

    Plan your finances with our calculator, updated for 2025 tax regulations.

    Calculate Tax →

    Salary Benchmark

    Get accurate, AI-supported salary trends to know your worth and negotiate better.

    Check Salaries →

    Interview Practice

    Practice for any interview with AI-enabled Q&A sessions. All data is private.

    Start Practicing →

    Interview Predictor

    Use our AI-supported tool to predict potential interview questions based on your resume.

    Predict Questions →

    Interview Practice Timer

    Use our mock interview trainer to perfect your answers under timed conditions.

    Start Timer →

    Behavioral Mastery

    Ace tricky behavioral interviews with our AI-powered practice module.

    Master Answers →

    Question Journal

    Confidentially record interview questions you were asked for future reference.

    Open Journal →

    Interview Ace

    A comprehensive tool to help you master every aspect of your interviews.

    Become an Ace →

    Q&A Logs

    Confidentially track your answers to common questions and refine them over time.

    View Logs →

    Application Planner

    Schedule and organize your job applications in one confidential planner.

    Open Planner →

    Cover Letter Tool

    Create perfect, tailored cover letters for each application with AI support.

    Generate Letter →

    Resume Score

    Get instant feedback on your resume with our NLP-supported analysis tool.

    Check My Score →

    ATS Score

    Check your resume's compatibility with Applicant Tracking Systems (ATS).

    Check ATS Score →

    Application Analyzer

    Use AI to analyze job descriptions and optimize your application materials.

    Analyze Application →

    Career Visualizer

    Confidentially plan and visualize your long-term career path and goals.

    Visualize My Career →

    Offer Genius

    Get intelligent insights and strategies to confidently negotiate job offers.

    Negotiate Offers →

    JobFlow

    Track your entire job search progress from application to offer with this intelligent tool.

    Track My Flow →

    JobSense

    Our intelligent matching engine that provides smart job recommendations.

    Get Smart Matches →

    Networking Toolkit

    Tools to build and manage your professional connections. All data is confidential.

    Build Network →

    Professional CV

    A classic, O*NET supported template for corporate and professional roles.

    Use This Template →

    Executive CV

    A premium, O*NET supported template designed for senior and C-level positions.

    Use This Template →

    Modern CV

    A fresh, stylish, O*NET supported template perfect for tech and modern industries.

    Use This Template →

    Creative CV

    A visually distinct, O*NET supported template for design and artistic roles.

    Use This Template →

    Minimalist CV

    A clean, simple, O*NET supported template that focuses purely on content.

    Use This Template →

    Europass CV

    The standard European Union recommended format for wide compatibility.

    Use This Template →

    Student CV

    An institution-recommended template perfect for internships and first jobs.

    Use This Template →

    Graduate CV

    An institution-recommended template for recent graduates entering the workforce.

    Use This Template →

    Academic CV

    The researcher-recommended format for roles in academia and research.

    Use This Template →

    Developer/IT CV

    A tech-savvy recommended template to highlight your technical skills.

    Use This Template →

    Skilled Worker CV

    A trades-recommended template to showcase hands-on skills and experience.

    Use This Template →

    Monochrome CV

    A sleek, black-and-white, O*NET supported template for a professional look.

    Use This Template →

    Art CV

    An artist-recommended template that allows your creativity to shine.

    Use This Template →

    Harvard CV

    A researcher-recommended template based on the classic Harvard format.

    Use This Template →

    Volunteer Research

    Help us improve our platform by joining our community research program.

    Join Research →

    Review Us

    Share your experience with our tools to help other job seekers.

    Share Experience →

    Register

    Create your free account to save jobs, build your profile, and track applications.

    Create Account →

    Login

    Access your dashboard, manage applications, and continue your job search.

    Access Your Account →

    Profile Builder

    Create a comprehensive professional profile that attracts recruiters and showcases your skills.

    Build Your Profile →

    View Profile

    See your public profile exactly as employers will see it. Make sure it's perfect.

    Preview Profile →

    Bookmarked Jobs

    Keep track of all your saved job opportunities in one organized place.

    View Saved Jobs →

    Your Reviews

    View and manage all the company reviews you've submitted.

    See Your Reviews →

    Following

    Manage the list of companies you follow to stay updated on their new openings.

    Manage Following →

    Find Companies

    Discover and research top employers in your country and industry.

    Discover Employers →

    Standalone CV Builder

    Use our O*NET supported CV builder to create a professional resume from scratch.

    Build Your CV →

    PDF to DOC (Beta)

    Convert your PDF resumes or documents into editable Word (DOC) format.

    Convert PDF →

    DOC to PDF (Beta)

    Create universally compatible PDF documents from your Word (DOC) files.

    Create PDF →

    General FAQ

    Find answers to common questions about our job site and platform.

    Read FAQ →

    Job Seekers FAQ

    Get help and find answers to questions specifically for job seekers.

    Get Help →

    Job Matching

    Learn about the technology and algorithms behind how we match you to jobs.

    Learn How →

    Personalized Matching

    Discover how we use your profile and activity to provide customized job suggestions.

    Learn More →

    Quick Apply

    Understand our fast application process and how to make the most of it.

    Learn More →

    Alert Frequency

    Learn how to manage your job alert settings so you get the updates you want.

    Manage Settings →

    Job Alerts Guide

    A complete guide to understanding how job alerts work and how to use them effectively.

    Read Guide →

    Resume Matching

    Learn how our system matches your resume to job requirements.

    Learn More →

    Ethical Branding

    Read our guide to building a professional and ethical personal brand.

    Read Guide →

    Candidate Visibility

    Learn how to increase your visibility to recruiters on our platform.

    Increase Visibility →

    Verified Badge

    Find out how you can get a verified badge to build trust with employers.

    Get Verified →

    AI ATS Technology

    Learn about the advanced AI and ATS technology that powers our platform.

    Learn More →

    ATS Ranking

    Understand how Applicant Tracking Systems rank you as an applicant.

    Learn More →

    Semantic Matching

    Learn how our AI-powered semantic matching goes beyond keywords.

    Learn More →

    💡 Tools that really enhance your application chances and career growth.

    Go to Your Dashboard →

      Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights