Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.
Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.
Algotale Lumiq (Full stack engineer)
About Algotale At Algotale, we believe in the transformative potential of data to reshape industries, drive innovation, and create unparalleled value. Established in 2020 by a team of passionate and visionary professionals, Algotale set out to red ...
Angular, Java Full Stack Architect
Principal Software Engineer The Dell Security & Resiliency organization manages security risks across all aspects of Dell's business. With team members located in over 15 countries, you will have an excellent opportunity to influence the security culture at Dell and further develop your career. ...
Lead Consultant, Full stack Developer
Ready to shape the future of work? At Genpact, we don’t just adapt to change—we drive it. AI and digital innovation are redefining industries, and we’re leading the charge. Genpact’s AI Gigafactory, our industry-first accelerator, is an example of how we’re scaling advanced technology solutions to hel ...
Full Stack Developer Senior Associate
Job Description :A bachelor’s degree in computer science or equivalent experience acquired on the job.About State StreetAcross the globe, institutional investors rely on us to help them manage risk, respond to challenges, and drive performance and profit ...
Senior Software Engineer, Full stack
ABOUT TRICOGTricog is a healthcare technology, product-based company headquartered in Bangalore. We build predictive and virtual diagnostic solutions for cardiovascular diseases, enabling clinicians to make faster, more accurate decisions that save lives.Our software directly su ...
Senior SAP Full Stack Developer
As a lead technology analyst. he/she should have a very good understanding of the technical architecture SAP landscape and define/suggest SAP best practices and Golden rules. Your area of responsibility will extend to deep technology root cause analysis, performance improvement,validations and source ...
Senior Technical Lead(Full Stack)
About Taglynk At Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we con ...
Responsibilities:• Translate application storyboards and use cases into functional applications • Design, build, and maintain efficient, reusable, and reliable code • Integrate data storage solutions may include databases, key-value stores, blob stores, etc. • Familiar with API Develo ...
Angular, Java Full Stack Architect
Principal Software Engineer The Dell Security & Resiliency organization manages security risks across all aspects of Dell's business.With team members located in over 15 countries, you will have an excellent opportunity to influence the security culture at Dell and further develop your career. ...
Full stack with java microservices
Tätigkeitsbereich:IT/TelekommunikationFachabteilung:Compliance Management ToolsGesellschaft:Mercedes-Benz Research and Development India Private LimitedStandort:Mercedes-Benz Research and Development India Private Limited, BangaloreStartdatum:sofortVeröffentlichungsdatum:..6Stellennummer:MERUEArbeitszeit:Vollzei ...
Senior Java Full Stack Developer
Lov.Cash is a mobile financial services platform aimed at consumers and businesses in emerging markets. We are developing innovative, accessible & affordable financial services solutions such as mobile wallets & payment terminals (POS) for sending and receiving digital currency. Lov.Cash provides an alternative ...
React Native Full Stack Developer
Job Description We are looking for a react native developer with 1-2 years of experience. Responsibilities.1. Develop and build mobile apps for iOS & Android devices using React Native Framework.2. Integrate Web API into mobile app code base.3. Manage 3rd Party API Integrations ...
Full Stack Developer Power Platform
Job SummaryThe Power Platform Developer will be responsible for designing, developing, and deploying business applications using Microsoft Power Apps, Power Automate, and Power BI. The role involves building Canvas and Model-Driven apps, automating business workflows, integr ...
Senior Full Stack Engineer ID69278
Job DescriptionAgileEngine is an Inc. 5000 company that creates award-winning software for Fortune 500 brands and trailblazing startups across 17+ industries. We rank among the leaders in areas like application development and AI/ML, and our people-first culture has earned us ...
Senior Developer ReactJS Full stack
Location: Bangalore out ring road, 3 days mandatory work from office at client locationExperience Range 6 - 10 YearsJob Type: 6 months contract + ext Need Immediate joiners only Jo ...
Full stack developer with Angular
We are hiring a Full Stack Java Developer with 5+ years of experience in designing and developing scalable web applications. The candidate should have strong expertise in Java, Spring Boot, Microservices, and REST API development. The ideal candidate must have hands-on experience in back ...
Application Developer – Python Full Stack
Hiring: Application Developer – Python Full Stack (Open Source + Azure)Location: Bangalore (Onsite) Experience: 8–10+ Years (Mandatory 8+ years Python Full Stack)Budget: Up to ₹21 LPAW ...
Senior Full Stack Java Developer
About the Role:We are looking for an experienced Full Stack Java Developer to be responsible for providing solutions for technical issues which may affect product delivery. The Full Stack Developer will facilitate requirement analyses, conduct peer reviews and provide feedback, and enh ...
Senior Engineer (Full stack) Postbot
Join Postman as an AI Builder : Are you excited about AI’s potential? Do you want to work toward the goal of using AI to help millions of developers be more effective at their jobs? At Postman, one of our goals is to create net new developers in the world, and we believe products li ...
Senior Java Full Stack Developer
Description We are currently seeking a highly proficient Senior Java Full Stack Developer to join our dynamic team. This ideal candidate will be instrumental in the design, development, and maintenance of high-quality and scalable full-stack applications utilizing ...
Job DescriptionThe Staff Web Engineer – Full Stack (Frontend Heavy) will play a key role in building scalable, consumer-facing web applications within the Marketplace domain in Experian Consumer Services. This role focuses on strong frontend development while having a good understanding o ...
Principal Consultant, Full stack Developer
Ready to shape the future of work? At Genpact, we don’t just adapt to change—we drive it. AI and digital innovation are redefining industries, and we’re leading the charge. Genpact’s AI Gigafactory, our industry-first accelerator, is an example of how we’re scaling advanced technology solutions to hel ...
SENIOR ENGINEER FULL STACK DEV
Role Summary We are looking for Full Stack Developers with strong backend expertise in Java and mandatory hands-on experience in Cloud (AWS or Azure). The role involves end-to-end development and cloud deployment of enterprise applications. Mandatory Technical Skills Candidate ...
Java Full stack Developer (Angular)
Role: Java with AngularSkill set: Java, Angular, Spring Boot, AWS, MicroservicesExperience: 3 to 9 Years Role DescriptionDesign, develop, and maintain Java-based applications using Spring Boot and Angular.Build and integrate REST APIs ...
Full Stack Hybris Developer Java/...
• Analysis, design, and implementation of business requirements utilizing Hybris technologies and spring methodology in Java EE • Experience developing high volume/transaction J2EE applications: OO/AD, Java, Servlets, JSP Spring, SoapUI, Junit/Testing • Experience with Model-View-Controller (MVC) frame ...
<div style=-webkit-user-drag: none; -webkit-tap-highlight-color: transparent; margin: 0px; padding: 0px; clear: both; cursor: text; overflow: visible; position: relati ...
Software Engineer II Full stack
Summary:GHX is looking for a Software Engineer with UI/frontend as well as backend and/or analytics experience. You should be able to demonstrate excellent problem-solving skills, self-motivated, highly detail oriented, able to context switch easily while working on multiple projects.You ...
ZoomInfo is where careers accelerate. We move fast, think boldly, and empower you to do the best work of your life. You’ll be surrounded by teammates who care deeply, challenge each other, and celebrate wins. With tools that amplify your impact and a culture that backs your ambition, you won’t just contribute ...
CRM Integration Engineer (Full Stack)
About Us:We ae a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, ...
Senior Technical Lead(Full Stack)
About TaglynkAt Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world-c ...
Full Stack AI Systems Engineer
Job Title: Senior GenAI Full Stack EngineerLocation: Hybrid- BengaluruEmployment Type: Full-Time With VDart DigitalWe are seeking a Senior GenAI Full Stack Engineer to design, build, and deploy advanced Agentic AI systems for ...
Principal Full Stack AI Engineer
We are hiring for a Senior Full-Stack Engineer (Front-End Leaning) with strong AI/agentic building experience to help completely rebuild and scale a human-blended AI coaching platform, and the role focuses on driving a complete architectural overhaul.The ideal candidate possesses a high level of agency ...
Staff Engineer, (Java Full stack)
This job is with Danaher, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Bring more to life.Are you ready to accelerate your potential and make a real difference within life sciences, diagno ...
Software Engineer Full Stack Development
This job is with Kyndryl, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world d ...
Full Stack Software Engineer (.NET)
Greetings,TCS is looking for .Net Full stack DeveloperExperience: 6 to 15 yearsEducation: Minimum 15 years of fulltime education (10th, 12th and Graduation)Location: Bangalore/Chennai<strong ...
Senior Full Stack Developer PHP
About the company Lexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success. Lexitas offers an array of services in ...
Java Full Stack Developer _2862
This job is with Allianz Commercial, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.OPEN POSITION·FULL-TIME·Full-StackJava DeveloperJava Backend + ...
Senior Full Stack Software Engineer
Software Development Engineer 2 This role involves developing scalable backend systems using Go, Python, and Node.Js, and crafting responsive frontends with Flutter and React.Js. The ideal candidate will have experience in CI/CD pipelines and deploying applications to the Play Store an ...
Senior Technical Lead(Full Stack)
About TaglynkAt Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we conne ...
Senior Technical Lead(Full Stack)
About TaglynkAt Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world-class leaders ...
Full Stack Generative AI Developer
About the CompanyQualiZeal, headquartered in Texas, USA, is a leading provider of AI-powered Quality Engineering services worldwide. With a diverse portfolio of digital transformation services including Quality Engineering, Digital Engineering, Advisory and Transformation, and Emerging ...
Senior Full Stack Developer PHP
About the company Lexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success. Lexitas offers an array of services ...
Software Engineer Full Stack Development
This job is with Kyndryl, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world d ...
Senior Technical Lead(Full Stack)
About Taglynk At Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world ...
Senior Technical Lead(Full Stack)
About TaglynkAt Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world-class leaders ...
Senior full stack developer php
About the companyLexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success.Lexitas offers an array of services including local and national c ...
Full Stack Engineer (AI-Native Builder)Experience: 7–12 yrs (flexible for demonstrated shipping velocity)This is a 5-day on-site role from HSR, BengaluruImmediate joiners preferredKindly do not ...
Java Full Stack Developer _2862
This job is with Allianz Commercial, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.OPEN POSITION·FULL-TIME·Full-StackJava DeveloperJava Backend + ...
Stand out from thousands of applicants. Use our proven career tools to optimize your applications and land your dream job faster.
Organize your job search and personal tasks. All data is confidential.
Open Planner →Access your confidential wellness report and resources to manage job search stress.
Check Wellbeing →Plan your skill development with O*NET support to stay competitive in your field.
Start Coaching →Get AI-powered suggestions on what to wear for your next interview.
Find Outfit →Plan your finances with our calculator, updated for 2025 tax regulations.
Calculate Tax →Get accurate, AI-supported salary trends to know your worth and negotiate better.
Check Salaries →Practice for any interview with AI-enabled Q&A sessions. All data is private.
Start Practicing →Use our AI-supported tool to predict potential interview questions based on your resume.
Predict Questions →Use our mock interview trainer to perfect your answers under timed conditions.
Start Timer →Ace tricky behavioral interviews with our AI-powered practice module.
Master Answers →Confidentially record interview questions you were asked for future reference.
Open Journal →A comprehensive tool to help you master every aspect of your interviews.
Become an Ace →Confidentially track your answers to common questions and refine them over time.
View Logs →Schedule and organize your job applications in one confidential planner.
Open Planner →Create perfect, tailored cover letters for each application with AI support.
Generate Letter →Get instant feedback on your resume with our NLP-supported analysis tool.
Check My Score →Check your resume's compatibility with Applicant Tracking Systems (ATS).
Check ATS Score →Use AI to analyze job descriptions and optimize your application materials.
Analyze Application →Confidentially plan and visualize your long-term career path and goals.
Visualize My Career →Get intelligent insights and strategies to confidently negotiate job offers.
Negotiate Offers →Track your entire job search progress from application to offer with this intelligent tool.
Track My Flow →Our intelligent matching engine that provides smart job recommendations.
Get Smart Matches →Tools to build and manage your professional connections. All data is confidential.
Build Network →A classic, O*NET supported template for corporate and professional roles.
Use This Template →A premium, O*NET supported template designed for senior and C-level positions.
Use This Template →A fresh, stylish, O*NET supported template perfect for tech and modern industries.
Use This Template →A visually distinct, O*NET supported template for design and artistic roles.
Use This Template →A clean, simple, O*NET supported template that focuses purely on content.
Use This Template →The standard European Union recommended format for wide compatibility.
Use This Template →An institution-recommended template perfect for internships and first jobs.
Use This Template →An institution-recommended template for recent graduates entering the workforce.
Use This Template →The researcher-recommended format for roles in academia and research.
Use This Template →A tech-savvy recommended template to highlight your technical skills.
Use This Template →A trades-recommended template to showcase hands-on skills and experience.
Use This Template →A sleek, black-and-white, O*NET supported template for a professional look.
Use This Template →An artist-recommended template that allows your creativity to shine.
Use This Template →A researcher-recommended template based on the classic Harvard format.
Use This Template →Help us improve our platform by joining our community research program.
Join Research →Share your experience with our tools to help other job seekers.
Share Experience →Create your free account to save jobs, build your profile, and track applications.
Create Account →Access your dashboard, manage applications, and continue your job search.
Access Your Account →Create a comprehensive professional profile that attracts recruiters and showcases your skills.
Build Your Profile →See your public profile exactly as employers will see it. Make sure it's perfect.
Preview Profile →Keep track of all your saved job opportunities in one organized place.
View Saved Jobs →View and manage all the company reviews you've submitted.
See Your Reviews →Manage the list of companies you follow to stay updated on their new openings.
Manage Following →Discover and research top employers in your country and industry.
Discover Employers →Use our O*NET supported CV builder to create a professional resume from scratch.
Build Your CV →Convert your PDF resumes or documents into editable Word (DOC) format.
Convert PDF →Create universally compatible PDF documents from your Word (DOC) files.
Create PDF →Find answers to common questions about our job site and platform.
Read FAQ →Get help and find answers to questions specifically for job seekers.
Get Help →Learn about the technology and algorithms behind how we match you to jobs.
Learn How →Discover how we use your profile and activity to provide customized job suggestions.
Learn More →Understand our fast application process and how to make the most of it.
Learn More →Learn how to manage your job alert settings so you get the updates you want.
Manage Settings →A complete guide to understanding how job alerts work and how to use them effectively.
Read Guide →Learn how our system matches your resume to job requirements.
Learn More →Read our guide to building a professional and ethical personal brand.
Read Guide →Learn how to increase your visibility to recruiters on our platform.
Increase Visibility →Find out how you can get a verified badge to build trust with employers.
Get Verified →Learn about the advanced AI and ATS technology that powers our platform.
Learn More →Understand how Applicant Tracking Systems rank you as an applicant.
Learn More →Learn how our AI-powered semantic matching goes beyond keywords.
Learn More →Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights
Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph uses a vertical bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each vertical bar represents a different job category, with the size of the vertical bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph uses a funnel chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the funnel represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,657,784+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
There are popular job portals and recruitment agencies active in India. India Jobs Expertini is one of the major portals that can help you find the right job. Expertini.Com can assist you in accessing a wide range of job listings and professional opportunities, in addition to its free CV Builder, Resume Score, and Job Alert tools.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.