• India Jobs Expertini profile avatar

    • 1,657,784+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

    Professional job seekers finding India jobs through Expertini
    750,000+ professionals on Expertini 750,000+ Candidates
    Join our global community
    Explore Leading Employers
    High-Paying Careers
    Expertini Penguin Mascot Resume Score™
    Resume Score™ Instantly
    Upload Your CV
    Quick 30-second process

    Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.

    1. Expertini
    2. India
    3. Jobs
    4. Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India

    5. Download PDF

    Reset

    Create Job Alert
      Add Alert

     
     
    Create Alert
     
    Reset

    Full Stack (Python and React)

    Priority 1: Full Stack (Python and React) - Position -2 Must-have skills: Total Experience must be 8 years Python Min 5 years in Python React Min 4 years in React AI capabilities Experience like LLM s, RAG, MCP ...

    Algotale Lumiq (Full stack engineer)

    About Algotale At Algotale, we believe in the transformative potential of data to reshape industries, drive innovation, and create unparalleled value. Established in 2020 by a team of passionate and visionary professionals, Algotale set out to red ...

    Angular, Java Full Stack Architect

    Principal Software Engineer The Dell Security & Resiliency organization manages security risks across all aspects of Dell's business. With team members located in over 15 countries, you will have an excellent opportunity to influence the security culture at Dell and further develop your career. ...

    Lead Consultant, Full stack Developer

    Ready to shape the future of work? At Genpact, we don’t just adapt to change—we drive it. AI and digital innovation are redefining industries, and we’re leading the charge. Genpact’s AI Gigafactory, our industry-first accelerator, is an example of how we’re scaling advanced technology solutions to hel ...

    Full Stack Developer Senior Associate

    Job Description :A bachelor’s degree in computer science or equivalent experience acquired on the job.About State StreetAcross the globe, institutional investors rely on us to help them manage risk, respond to challenges, and drive performance and profit ...

    Senior Software Engineer, Full stack

    ABOUT TRICOGTricog is a healthcare technology, product-based company headquartered in Bangalore. We build predictive and virtual diagnostic solutions for cardiovascular diseases, enabling clinicians to make faster, more accurate decisions that save lives.Our software directly su ...

    Senior SAP Full Stack Developer

    As a lead technology analyst. he/she should have a very good understanding of the technical architecture SAP landscape and define/suggest SAP best practices and Golden rules. Your area of responsibility will extend to deep technology root cause analysis, performance improvement,validations and source ...

    Senior Technical Lead(Full Stack)

    About Taglynk At Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we con ...

    DOT NET Developer full stack

    Responsibilities:• Translate application storyboards and use cases into functional applications • Design, build, and maintain efficient, reusable, and reliable code • Integrate data storage solutions may include databases, key-value stores, blob stores, etc. • Familiar with API Develo ...

    Angular, Java Full Stack Architect

    Principal Software Engineer The Dell Security & Resiliency organization manages security risks across all aspects of Dell's business.With team members located in over 15 countries, you will have an excellent opportunity to influence the security culture at Dell and further develop your career. ...

    Full stack with java microservices

    Tätigkeitsbereich:IT/TelekommunikationFachabteilung:Compliance Management ToolsGesellschaft:Mercedes-Benz Research and Development India Private LimitedStandort:Mercedes-Benz Research and Development India Private Limited, BangaloreStartdatum:sofortVeröffentlichungsdatum:..6Stellennummer:MERUEArbeitszeit:Vollzei ...

    Senior Java Full Stack Developer

    Lov.Cash is a mobile financial services platform aimed at consumers and businesses in emerging markets. We are developing innovative, accessible & affordable financial services solutions such as mobile wallets & payment terminals (POS) for sending and receiving digital currency. Lov.Cash provides an alternative ...

    React Native Full Stack Developer

    Job Description We are looking for a react native developer with 1-2 years of experience. Responsibilities.1. Develop and build mobile apps for iOS & Android devices using React Native Framework.2. Integrate Web API into mobile app code base.3. Manage 3rd Party API Integrations ...

    Full Stack Developer Power Platform

    Job SummaryThe Power Platform Developer will be responsible for designing, developing, and deploying business applications using Microsoft Power Apps, Power Automate, and Power BI. The role involves building Canvas and Model-Driven apps, automating business workflows, integr ...

    Senior Full Stack Engineer ID69278

    Job DescriptionAgileEngine is an Inc. 5000 company that creates award-winning software for Fortune 500 brands and trailblazing startups across 17+ industries. We rank among the leaders in areas like application development and AI/ML, and our people-first culture has earned us ...

    Senior Developer ReactJS Full stack

    Location: Bangalore out ring road, 3 days mandatory work from office at client locationExperience Range 6 - 10 YearsJob Type: 6 months contract + ext Need Immediate joiners only Jo ...

    Full stack developer with Angular

    We are hiring a Full Stack Java Developer with 5+ years of experience in designing and developing scalable web applications. The candidate should have strong expertise in Java, Spring Boot, Microservices, and REST API development. The ideal candidate must have hands-on experience in back ...

    Application Developer – Python Full Stack

    Hiring: Application Developer – Python Full Stack (Open Source + Azure)Location: Bangalore (Onsite) Experience: 8–10+ Years (Mandatory 8+ years Python Full Stack)Budget: Up to ₹21 LPAW ...

    Senior Full Stack Java Developer

    About the Role:We are looking for an experienced Full Stack Java Developer to be responsible for providing solutions for technical issues which may affect product delivery. The Full Stack Developer will facilitate requirement analyses, conduct peer reviews and provide feedback, and enh ...

    Senior Engineer (Full stack) Postbot

    Join Postman as an AI Builder : Are you excited about AI’s potential? Do you want to work toward the goal of using AI to help millions of developers be more effective at their jobs? At Postman, one of our goals is to create net new developers in the world, and we believe products li ...

    Senior Java Full Stack Developer

    Description We are currently seeking a highly proficient Senior Java Full Stack Developer to join our dynamic team. This ideal candidate will be instrumental in the design, development, and maintenance of high-quality and scalable full-stack applications utilizing ...

    Staff Web Engineer Full Stack

    Job DescriptionThe Staff Web Engineer – Full Stack (Frontend Heavy) will play a key role in building scalable, consumer-facing web applications within the Marketplace domain in Experian Consumer Services. This role focuses on strong frontend development while having a good understanding o ...

    Principal Consultant, Full stack Developer

    Ready to shape the future of work? At Genpact, we don’t just adapt to change—we drive it. AI and digital innovation are redefining industries, and we’re leading the charge. Genpact’s AI Gigafactory, our industry-first accelerator, is an example of how we’re scaling advanced technology solutions to hel ...

    TechOps DE Full Stack Manager

    At EY, we’re all in to shape your future with confidence. We’ll help you succeed in a globally connected powerhouse of diverse teams and take your career wherever you want it to go. Join EY and help to build a better working world. Career Family - DE TechOpsRole Ty ...

    SENIOR ENGINEER FULL STACK DEV

    Role Summary We are looking for Full Stack Developers with strong backend expertise in Java and mandatory hands-on experience in Cloud (AWS or Azure). The role involves end-to-end development and cloud deployment of enterprise applications. Mandatory Technical Skills Candidate ...

    Java Full stack Developer (Angular)

    Role: Java with AngularSkill set: Java, Angular, Spring Boot, AWS, MicroservicesExperience: 3 to 9 Years Role DescriptionDesign, develop, and maintain Java-based applications using Spring Boot and Angular.Build and integrate REST APIs ...

    Full Stack Hybris Developer Java/...

    • Analysis, design, and implementation of business requirements utilizing Hybris technologies and spring methodology in Java EE • Experience developing high volume/transaction J2EE applications: OO/AD, Java, Servlets, JSP Spring, SoapUI, Junit/Testing • Experience with Model-View-Controller (MVC) frame ...

    Full Stack Lead Engineer(C#)

    <div style=-webkit-user-drag: none; -webkit-tap-highlight-color: transparent; margin: 0px; padding: 0px; clear: both; cursor: text; overflow: visible; position: relati ...

    Software Engineer II Full stack

    Summary:GHX is looking for a Software Engineer with UI/frontend as well as backend and/or analytics experience. You should be able to demonstrate excellent problem-solving skills, self-motivated, highly detail oriented, able to context switch easily while working on multiple projects.You ...

    Senior Full Stack Engineer AI

    ZoomInfo is where careers accelerate. We move fast, think boldly, and empower you to do the best work of your life. You’ll be surrounded by teammates who care deeply, challenge each other, and celebrate wins. With tools that amplify your impact and a culture that backs your ambition, you won’t just contribute ...

    CRM Integration Engineer (Full Stack)

    About Us:We ae a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, ...

    Senior Technical Lead(Full Stack)

    About TaglynkAt Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world-c ...

    Full Stack AI Systems Engineer

    Job Title: Senior GenAI Full Stack EngineerLocation: Hybrid- BengaluruEmployment Type: Full-Time With VDart DigitalWe are seeking a Senior GenAI Full Stack Engineer to design, build, and deploy advanced Agentic AI systems for ...

    Principal Full Stack AI Engineer

    We are hiring for a Senior Full-Stack Engineer (Front-End Leaning) with strong AI/agentic building experience to help completely rebuild and scale a human-blended AI coaching platform, and the role focuses on driving a complete architectural overhaul.The ideal candidate possesses a high level of agency ...

    Staff Engineer, (Java Full stack)

    This job is with Danaher, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Bring more to life.Are you ready to accelerate your potential and make a real difference within life sciences, diagno ...

    Software Engineer Full Stack Development

    This job is with Kyndryl, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world d ...

    Full Stack Software Engineer (.NET)

    Greetings,TCS is looking for .Net Full stack DeveloperExperience: 6 to 15 yearsEducation: Minimum 15 years of fulltime education (10th, 12th and Graduation)Location: Bangalore/Chennai<strong ...

    Senior Full Stack Developer PHP

    About the company Lexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success. Lexitas offers an array of services in ...

    Java Full Stack Developer _2862

    This job is with Allianz Commercial, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.OPEN POSITION·FULL-TIME·Full-StackJava DeveloperJava Backend + ...

    Senior Full Stack Software Engineer

    Software Development Engineer 2 This role involves developing scalable backend systems using Go, Python, and Node.Js, and crafting responsive frontends with Flutter and React.Js. The ideal candidate will have experience in CI/CD pipelines and deploying applications to the Play Store an ...

    Senior Technical Lead(Full Stack)

    About TaglynkAt Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we conne ...

    Senior Technical Lead(Full Stack)

    About TaglynkAt Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world-class leaders ...

    Full Stack Generative AI Developer

    About the CompanyQualiZeal, headquartered in Texas, USA, is a leading provider of AI-powered Quality Engineering services worldwide. With a diverse portfolio of digital transformation services including Quality Engineering, Digital Engineering, Advisory and Transformation, and Emerging ...

    Senior Full Stack Developer PHP

    About the company Lexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success. Lexitas offers an array of services ...

    Software Engineer Full Stack Development

    This job is with Kyndryl, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world d ...

    Senior Technical Lead(Full Stack)

    About Taglynk At Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world ...

    Senior Technical Lead(Full Stack)

    About TaglynkAt Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world-class leaders ...

    Senior full stack developer php

    About the companyLexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success.Lexitas offers an array of services including local and national c ...

    Lead Full Stack AI Developer

    Full Stack Engineer (AI-Native Builder)Experience: 7–12 yrs (flexible for demonstrated shipping velocity)This is a 5-day on-site role from HSR, BengaluruImmediate joiners preferredKindly do not ...

    Java Full Stack Developer _2862

    This job is with Allianz Commercial, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.OPEN POSITION·FULL-TIME·Full-StackJava DeveloperJava Backend + ...

    🚀 Boost Your Hiring Chances with Our AI-Powered Tool-Kit

    Stand out from thousands of applicants. Use our proven career tools to optimize your applications and land your dream job faster.

    To-Do Planner

    Organize your job search and personal tasks. All data is confidential.

    Open Planner →

    Wellbeing Center

    Access your confidential wellness report and resources to manage job search stress.

    Check Wellbeing →

    Skill Coach

    Plan your skill development with O*NET support to stay competitive in your field.

    Start Coaching →

    Outfit Helper

    Get AI-powered suggestions on what to wear for your next interview.

    Find Outfit →

    Income Tax Calculator

    Plan your finances with our calculator, updated for 2025 tax regulations.

    Calculate Tax →

    Salary Benchmark

    Get accurate, AI-supported salary trends to know your worth and negotiate better.

    Check Salaries →

    Interview Practice

    Practice for any interview with AI-enabled Q&A sessions. All data is private.

    Start Practicing →

    Interview Predictor

    Use our AI-supported tool to predict potential interview questions based on your resume.

    Predict Questions →

    Interview Practice Timer

    Use our mock interview trainer to perfect your answers under timed conditions.

    Start Timer →

    Behavioral Mastery

    Ace tricky behavioral interviews with our AI-powered practice module.

    Master Answers →

    Question Journal

    Confidentially record interview questions you were asked for future reference.

    Open Journal →

    Interview Ace

    A comprehensive tool to help you master every aspect of your interviews.

    Become an Ace →

    Q&A Logs

    Confidentially track your answers to common questions and refine them over time.

    View Logs →

    Application Planner

    Schedule and organize your job applications in one confidential planner.

    Open Planner →

    Cover Letter Tool

    Create perfect, tailored cover letters for each application with AI support.

    Generate Letter →

    Resume Score

    Get instant feedback on your resume with our NLP-supported analysis tool.

    Check My Score →

    ATS Score

    Check your resume's compatibility with Applicant Tracking Systems (ATS).

    Check ATS Score →

    Application Analyzer

    Use AI to analyze job descriptions and optimize your application materials.

    Analyze Application →

    Career Visualizer

    Confidentially plan and visualize your long-term career path and goals.

    Visualize My Career →

    Offer Genius

    Get intelligent insights and strategies to confidently negotiate job offers.

    Negotiate Offers →

    JobFlow

    Track your entire job search progress from application to offer with this intelligent tool.

    Track My Flow →

    JobSense

    Our intelligent matching engine that provides smart job recommendations.

    Get Smart Matches →

    Networking Toolkit

    Tools to build and manage your professional connections. All data is confidential.

    Build Network →

    Professional CV

    A classic, O*NET supported template for corporate and professional roles.

    Use This Template →

    Executive CV

    A premium, O*NET supported template designed for senior and C-level positions.

    Use This Template →

    Modern CV

    A fresh, stylish, O*NET supported template perfect for tech and modern industries.

    Use This Template →

    Creative CV

    A visually distinct, O*NET supported template for design and artistic roles.

    Use This Template →

    Minimalist CV

    A clean, simple, O*NET supported template that focuses purely on content.

    Use This Template →

    Europass CV

    The standard European Union recommended format for wide compatibility.

    Use This Template →

    Student CV

    An institution-recommended template perfect for internships and first jobs.

    Use This Template →

    Graduate CV

    An institution-recommended template for recent graduates entering the workforce.

    Use This Template →

    Academic CV

    The researcher-recommended format for roles in academia and research.

    Use This Template →

    Developer/IT CV

    A tech-savvy recommended template to highlight your technical skills.

    Use This Template →

    Skilled Worker CV

    A trades-recommended template to showcase hands-on skills and experience.

    Use This Template →

    Monochrome CV

    A sleek, black-and-white, O*NET supported template for a professional look.

    Use This Template →

    Art CV

    An artist-recommended template that allows your creativity to shine.

    Use This Template →

    Harvard CV

    A researcher-recommended template based on the classic Harvard format.

    Use This Template →

    Volunteer Research

    Help us improve our platform by joining our community research program.

    Join Research →

    Review Us

    Share your experience with our tools to help other job seekers.

    Share Experience →

    Register

    Create your free account to save jobs, build your profile, and track applications.

    Create Account →

    Login

    Access your dashboard, manage applications, and continue your job search.

    Access Your Account →

    Profile Builder

    Create a comprehensive professional profile that attracts recruiters and showcases your skills.

    Build Your Profile →

    View Profile

    See your public profile exactly as employers will see it. Make sure it's perfect.

    Preview Profile →

    Bookmarked Jobs

    Keep track of all your saved job opportunities in one organized place.

    View Saved Jobs →

    Your Reviews

    View and manage all the company reviews you've submitted.

    See Your Reviews →

    Following

    Manage the list of companies you follow to stay updated on their new openings.

    Manage Following →

    Find Companies

    Discover and research top employers in your country and industry.

    Discover Employers →

    Standalone CV Builder

    Use our O*NET supported CV builder to create a professional resume from scratch.

    Build Your CV →

    PDF to DOC (Beta)

    Convert your PDF resumes or documents into editable Word (DOC) format.

    Convert PDF →

    DOC to PDF (Beta)

    Create universally compatible PDF documents from your Word (DOC) files.

    Create PDF →

    General FAQ

    Find answers to common questions about our job site and platform.

    Read FAQ →

    Job Seekers FAQ

    Get help and find answers to questions specifically for job seekers.

    Get Help →

    Job Matching

    Learn about the technology and algorithms behind how we match you to jobs.

    Learn How →

    Personalized Matching

    Discover how we use your profile and activity to provide customized job suggestions.

    Learn More →

    Quick Apply

    Understand our fast application process and how to make the most of it.

    Learn More →

    Alert Frequency

    Learn how to manage your job alert settings so you get the updates you want.

    Manage Settings →

    Job Alerts Guide

    A complete guide to understanding how job alerts work and how to use them effectively.

    Read Guide →

    Resume Matching

    Learn how our system matches your resume to job requirements.

    Learn More →

    Ethical Branding

    Read our guide to building a professional and ethical personal brand.

    Read Guide →

    Candidate Visibility

    Learn how to increase your visibility to recruiters on our platform.

    Increase Visibility →

    Verified Badge

    Find out how you can get a verified badge to build trust with employers.

    Get Verified →

    AI ATS Technology

    Learn about the advanced AI and ATS technology that powers our platform.

    Learn More →

    ATS Ranking

    Understand how Applicant Tracking Systems rank you as an applicant.

    Learn More →

    Semantic Matching

    Learn how our AI-powered semantic matching goes beyond keywords.

    Learn More →

    💡 Tools that really enhance your application chances and career growth.

    Go to Your Dashboard →

      Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights