1,657,784+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

Professional job seekers finding India jobs through Expertini
750,000+ professionals on Expertini 750,000+ Candidates
Join our global community
Expertini Penguin Mascot Resume Score™
Resume Score™ Instantly
Upload Your CV
Quick 30-second process

Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.

Reset

Create Job Alert

 
   
Reset

Principal Consultant, Full stack Developer

Ready to shape the future of work? At Genpact, we don’t just adapt to change—we drive it. AI and digital innovation are redefining industries, and we’re leading the charge. Genpact’s AI Gigafactory, our industry-first accelerator, is an example of how we’re scaling advanced technology solutions to hel ...

TechOps DE Full Stack Manager

At EY, we’re all in to shape your future with confidence. We’ll help you succeed in a globally connected powerhouse of diverse teams and take your career wherever you want it to go. Join EY and help to build a better working world. Career Family - DE TechOpsRole Ty ...

SENIOR ENGINEER FULL STACK DEV

Role Summary We are looking for Full Stack Developers with strong backend expertise in Java and mandatory hands-on experience in Cloud (AWS or Azure). The role involves end-to-end development and cloud deployment of enterprise applications. Mandatory Technical Skills Candidate ...

Software Engineer Full Stack Java

Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ou ...

Invoyz Full Stack Software Development

Job Title: Senior Software Developer [Full Stack] Location: Bengaluru About Company: Invoyz Financial Solutions Pvt. Ltd. is a Bengaluru based financial services technology start-up with a fo ...

Sr. Software Engineer, Full stack

Job Overview We’re looking for a Senior software developer to join our development team working on developing our core products. You’ll work with a manager and software development team on several features of our products and be involved in the concept-to-delivery of high-quality solutions. ...

Full Stack Developer (Node.js & React.js)

Job SummarySynechron is seeking a skilled Full Stack Developer with extensive experience in Node.js and React.js to support the development of scalable, high-performance enterprise applications. This role involves designing, developing, and maintaining robust front-end and back-end systems, integr ...

Full stack developer with Angular

We are hiring a Full Stack Java Developer with 5+ years of experience in designing and developing scalable web applications. The candidate should have strong expertise in Java, Spring Boot, Microservices, and REST API development. The ideal candidate must have hands-on experience in backend development usi ...

Full Stack Developer Power Platform

Job SummaryThe Power Platform Developer will be responsible for designing, developing, and deploying business applications using Microsoft Power Apps, Power Automate, and Power BI. The role involves building Canvas and Model-Driven apps, automating business workflows, integr ...

Senior Full Stack Engineer ID69278

Job DescriptionAgileEngine is an Inc. 5000 company that creates award-winning software for Fortune 500 brands and trailblazing startups across 17+ industries. We rank among the leaders in areas like application development and AI/ML, and our people-first culture has earned us ...

Raven: Full stack Engineer Role

Raven is a YC-backed startup (S22) building AI assistants for manufacturing plants. We're taking decades of manufacturing expertise and combining it with AI to solve real operational problems. Backed by top VCs, we're a small, focused team working to make industrial operations safer, smarter, and more efficie ...

Lead Consultant, Full Stack Developer

Ready to build the future with AI? At Genpact, we don’t just keep up with technology—we set the pace. AI and digital innovation are redefining industries, and we’re leading the charge. Genpact’s AI Gigafactory, our industry-first accelerator, is an example of how we’re scaling advanced technology solutions to ...

Senior Software Engineer Full Stack

Company Overview Docusign brings agreements to life. Over 1.5 million customers and more than a billion people in over 180 countries use Docusign solutions to accelerate the process of doing business and simplify people’s lives. With intelligent agreement management, Docusign unleashes business-critical data tha ...

Senior Full Stack Engineer ID69278

AgileEngine is an Inc. 5000 company that creates award-winning software for Fortune 500 brands and trailblazing startups across 17+ industries. We rank among the leaders in areas like application development and AI/ML, and our people-first culture has earned us multiple Best Place to Wor ...

Senior Developer ReactJS Full stack

Location: Bangalore out ring road, 3 days mandatory work from office at client locationExperience Range 6 - 10 YearsJob Type: 6 months contract + ext Need Immediate joiners only Jo ...

Full stack developer with Angular

We are hiring a Full Stack Java Developer with 5+ years of experience in designing and developing scalable web applications. The candidate should have strong expertise in Java, Spring Boot, Microservices, and REST API development. The ideal candidate must have hands-on experience in back ...

Java Full Stack Developer Manager

Who we are looking for:As a Senior Lead Developer, the candidate will be responsible for designing and developing solutions for GTS Integration Services team. The candidate must have 10+ years of experience in developing web applications in Java, JavaScript frameworks, Spring MVC and Microservic ...

Full Stack Software Development Engineer

Job Description: We are seeking a talented Full Stack Software Development Engineer (SDE-1) to join our dynamic team. You will collaborate with cross-functional teams to deliver high-quality software solutions that meet our customers' needs. Responsibilities: Strong knowledge and experience on server-side develo ...

Principal Full Stack AI Engineer

We are hiring for a Senior Full-Stack Engineer (Front-End Leaning) with strong AI/agentic building experience to help completely rebuild and scale a human-blended AI coaching platform, and the role focuses on driving a complete architectural overhaul.The ideal candidate possesses a high level of agency ...

Full Stack Automation Test Developer

About the Role:We are looking for an experienced Senior QA Automation Engineer (Playwright with Typescript / JavaScript) to join our engineering team. The ideal candidate will be instrumental in building scalable automation frameworks, enhancing test coverage, and ensuring high-quality software deliver ...

Full Stack Software Engineer (.NET)

Greetings,TCS is looking for .Net Full stack DeveloperExperience: 6 to 15 yearsEducation: Minimum 15 years of fulltime education (10th, 12th and Graduation)Location: Bangalore/Chennai<strong ...

Senior Full Stack Developer PHP

About the company Lexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success. Lexitas offers an array of services in ...

Full Stack AI Systems Engineer

Job Title: Senior GenAI Full Stack EngineerLocation: Hybrid- BengaluruEmployment Type: Full-Time With VDart DigitalWe are seeking a Senior GenAI Full Stack Engineer to design, build, and deploy advanced Agentic AI systems for ...

Principal Full Stack AI Engineer

We are hiring for a Senior Full-Stack Engineer (Front-End Leaning) with strong AI/agentic building experience to help completely rebuild and scale a human-blended AI coaching platform, and the role focuses on driving a complete architectural overhaul.The ideal candidate possesses a high level of agency ...

Staff Engineer, (Java Full stack)

This job is with Danaher, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Bring more to life.Are you ready to accelerate your potential and make a real difference within life sciences, diagno ...

Senior Technical Lead(Full Stack)

About TaglynkAt Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we conne ...

Lead Full Stack AI Developer

Full Stack Engineer (AI-Native Builder)Experience: 7–12 yrs (flexible for demonstrated shipping velocity)This is a 5-day on-site role from HSR, BengaluruImmediate joiners preferredKindly do not ...

Senior full stack developer php

About the companyLexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success.Lexitas offers an array of services including local and national c ...

Senior Full Stack Developer PHP

About the company Lexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success. Lexitas offers an array of services ...

Software Engineer Full Stack Development

This job is with Kyndryl, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world d ...

Software Engineer Full Stack Java

This job is with Kyndryl, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world d ...

Senior Technical Lead(Full Stack)

About Taglynk At Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world ...

Senior Full Stack Software Engineer

Software Development Engineer 2 This role involves developing scalable backend systems using Go, Python, and Node.Js, and crafting responsive frontends with Flutter and React.Js. The ideal candidate will have experience in CI/CD pipelines and deploying applications to the Play Store an ...

Full Stack Adjacent Backend Developer

I’m Hiring a Backend Engineer (Top 10% Only) Location: Bangalore (On-site) Experience: 2–6 YearsI run ClearStack. We build serious, scalable systems for global clients. We move fast. We ship often. We fix what breaks. No politics. No passenge ...

Associate Full Stack Engineer (AWS)

AWS Full Stack SDE (Mid/Junior Level) Location: Hyderabad (Work from Office) Employment Type: Full-Time Experience: 2–6 YearsRole OverviewWe are hiring AWS Full Stack Software Development Engineers (SDEs) to work on enterpri ...

Software Engineer Full Stack Development

This job is with Kyndryl, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world d ...

Principal Java Full Stack Engineer

Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benefits, data and resources they need to feel their best. Here, you will fin ...

Software Engineer Full Stack Development

Who We AreAt Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a las ...

Full Stack Data Engineer APO

Full-Stack Data Engineer - APO Ga terugApplyEneco - Rotterdam> 5 jaarData & AI, Tech€83.000 - €117.000 Deel op social media:Full-Stack Data Engineer - APOEneco - Rotterdam<li ...

Senior Engineer (Full stack), Monitoring

Postman is the world’s leading API platform, used by more than 30 million developers and 500,000 organizations, including 98% of the Fortune 500. Postman is helping developers and professionals across the globe build the API-first world by simplifying each step of the API lifecycle and streamlining collabora ...

Fold Health Full Stack Developer

Job Title: Full Stack Developer Experience: 3+ years Location: Pune (Amar Tech Park, Balewadi, Pune) – Full-time, On-site Domain: Healthcare (Preferred) ______________ About Fold Health ...

Full Stack Developer Internship Unpaid

Full-Stack Developer Internship Location: Bengaluru Employment Type: Internship (3-6 months)  Experience Level: Entry-Level/Recent Graduate  <sp ...

Sr. Software Engineer Full Stack

{railsEnv:production,inMailer:false,i18nLocale:en,i18nDefaultLocale:en,rorVersion:13.0.2,rorPro:false,href: ...

Senior Applications Developer (Full Stack)

Seeking a highly skilled Senior Full Stack Developer with 12–15 years of experience building secure, scalable enterprise web applications. The ideal candidate is an expert in ASP.NET Core, MVC, C#, .NET Framework, and modern front end development using HTML, CSS, JavaScript, TypeScript, Vue.js, Pinia, Vite, a ...

Principal Engineer Java Full Stack

HARMAN’s engineers and designers are creative, purposeful and agile. As part of this team, you’ll combine your technical expertise with innovative ideas to help drive cutting-edge solutions in the car, enterprise and connected ecosystem. Every day, you will push the boundaries of creative design, and HA ...

Staff Engineer .Net Full Stack

Company SummaryFirst American (India) is a GCC (Global Capability Center) of the First American Financial Corporation (NYSE: FAF) family of companies. FAI is a proud member of the FORTUNE 500 companies and has been amongst the Fortune 100 Best Companies to Work For® list for eight consecut ...

Senior Full Stack Engineer AI

ZoomInfo is where careers accelerate. We move fast, think boldly, and empower you to do the best work of your life. You’ll be surrounded by teammates who care deeply, challenge each other, and celebrate wins. With tools that amplify your impact and a culture that backs your ambition, you won’t just contribute ...

Full stack developer with Angular

Job DescriptionWe are hiring a Full Stack Java Developer with 5+ years of experience in designing and developing scalable web applications. The candidate should have strong expertise in Java, Spring Boot, Microservices, and REST API development. The ideal candidate must have h ...

Senior Developer ReactJS Full stack

Greetings from ALIQAN Technologies!!!We are hiring a Senior Developer - ReactJS Full stack for one of our clients' MNCs.Location: Bangalore out ring road, 3 days mandatory work from office at client location ...

.Net Angular Full Stack developer

Our storyAt Alight, we believe a company’s success starts with its people. At our core, we Champion People, help our colleagues Grow with Purpose and true to our name we encourage colleagues to “Be Alight.”Our Values:Champion People – be empathetic and help create a p ...

🚀 Boost Your Hiring Chances with Our AI-Powered Tool-Kit

Stand out from thousands of applicants. Use our proven career tools to optimize your applications and land your dream job faster.

To-Do Planner

Organize your job search and personal tasks. All data is confidential.

Open Planner

Wellbeing Center

Access your confidential wellness report and resources to manage job search stress.

Check Wellbeing

Skill Coach

Plan your skill development with O*NET support to stay competitive in your field.

Start Coaching

Outfit Helper

Get AI-powered suggestions on what to wear for your next interview.

Find Outfit

Income Tax Calculator

Plan your finances with our calculator, updated for 2025 tax regulations.

Calculate Tax

Salary Benchmark

Get accurate, AI-supported salary trends to know your worth and negotiate better.

Check Salaries

Interview Practice

Practice for any interview with AI-enabled Q&A sessions. All data is private.

Start Practicing

Interview Predictor

Use our AI-supported tool to predict potential interview questions based on your resume.

Predict Questions

Interview Practice Timer

Use our mock interview trainer to perfect your answers under timed conditions.

Start Timer

Behavioral Mastery

Ace tricky behavioral interviews with our AI-powered practice module.

Master Answers

Question Journal

Confidentially record interview questions you were asked for future reference.

Open Journal

Interview Ace

A comprehensive tool to help you master every aspect of your interviews.

Become an Ace

Q&A Logs

Confidentially track your answers to common questions and refine them over time.

View Logs

Application Planner

Schedule and organize your job applications in one confidential planner.

Open Planner

Cover Letter Tool

Create perfect, tailored cover letters for each application with AI support.

Generate Letter

Resume Score

Get instant feedback on your resume with our NLP-supported analysis tool.

Check My Score

ATS Score

Check your resume's compatibility with Applicant Tracking Systems (ATS).

Check ATS Score

Application Analyzer

Use AI to analyze job descriptions and optimize your application materials.

Analyze Application

Career Visualizer

Confidentially plan and visualize your long-term career path and goals.

Visualize My Career

Offer Genius

Get intelligent insights and strategies to confidently negotiate job offers.

Negotiate Offers

JobFlow

Track your entire job search progress from application to offer with this intelligent tool.

Track My Flow

JobSense

Our intelligent matching engine that provides smart job recommendations.

Get Smart Matches

Networking Toolkit

Tools to build and manage your professional connections. All data is confidential.

Build Network

Professional CV

A classic, O*NET supported template for corporate and professional roles.

Use This Template

Executive CV

A premium, O*NET supported template designed for senior and C-level positions.

Use This Template

Modern CV

A fresh, stylish, O*NET supported template perfect for tech and modern industries.

Use This Template

Creative CV

A visually distinct, O*NET supported template for design and artistic roles.

Use This Template

Minimalist CV

A clean, simple, O*NET supported template that focuses purely on content.

Use This Template

Europass CV

The standard European Union recommended format for wide compatibility.

Use This Template

Student CV

An institution-recommended template perfect for internships and first jobs.

Use This Template

Graduate CV

An institution-recommended template for recent graduates entering the workforce.

Use This Template

Academic CV

The researcher-recommended format for roles in academia and research.

Use This Template

Developer/IT CV

A tech-savvy recommended template to highlight your technical skills.

Use This Template

Skilled Worker CV

A trades-recommended template to showcase hands-on skills and experience.

Use This Template

Monochrome CV

A sleek, black-and-white, O*NET supported template for a professional look.

Use This Template

Art CV

An artist-recommended template that allows your creativity to shine.

Use This Template

Harvard CV

A researcher-recommended template based on the classic Harvard format.

Use This Template

Volunteer Research

Help us improve our platform by joining our community research program.

Join Research

Review Us

Share your experience with our tools to help other job seekers.

Share Experience

Register

Create your free account to save jobs, build your profile, and track applications.

Create Account

Login

Access your dashboard, manage applications, and continue your job search.

Access Your Account

Profile Builder

Create a comprehensive professional profile that attracts recruiters and showcases your skills.

Build Your Profile

View Profile

See your public profile exactly as employers will see it. Make sure it's perfect.

Preview Profile

Bookmarked Jobs

Keep track of all your saved job opportunities in one organized place.

View Saved Jobs

Your Reviews

View and manage all the company reviews you've submitted.

See Your Reviews

Following

Manage the list of companies you follow to stay updated on their new openings.

Manage Following

Find Companies

Discover and research top employers in your country and industry.

Discover Employers

Standalone CV Builder

Use our O*NET supported CV builder to create a professional resume from scratch.

Build Your CV

PDF to DOC (Beta)

Convert your PDF resumes or documents into editable Word (DOC) format.

Convert PDF

DOC to PDF (Beta)

Create universally compatible PDF documents from your Word (DOC) files.

Create PDF

General FAQ

Find answers to common questions about our job site and platform.

Read FAQ

Job Seekers FAQ

Get help and find answers to questions specifically for job seekers.

Get Help

Job Matching

Learn about the technology and algorithms behind how we match you to jobs.

Learn How

Personalized Matching

Discover how we use your profile and activity to provide customized job suggestions.

Learn More

Quick Apply

Understand our fast application process and how to make the most of it.

Learn More

Alert Frequency

Learn how to manage your job alert settings so you get the updates you want.

Manage Settings

Job Alerts Guide

A complete guide to understanding how job alerts work and how to use them effectively.

Read Guide

Resume Matching

Learn how our system matches your resume to job requirements.

Learn More

Ethical Branding

Read our guide to building a professional and ethical personal brand.

Read Guide

Candidate Visibility

Learn how to increase your visibility to recruiters on our platform.

Increase Visibility

Verified Badge

Find out how you can get a verified badge to build trust with employers.

Get Verified

AI ATS Technology

Learn about the advanced AI and ATS technology that powers our platform.

Learn More

ATS Ranking

Understand how Applicant Tracking Systems rank you as an applicant.

Learn More

Semantic Matching

Learn how our AI-powered semantic matching goes beyond keywords.

Learn More

    Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights