Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.
Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.
Principal Consultant, Full stack Developer
Ready to shape the future of work? At Genpact, we don’t just adapt to change—we drive it. AI and digital innovation are redefining industries, and we’re leading the charge. Genpact’s AI Gigafactory, our industry-first accelerator, is an example of how we’re scaling advanced technology solutions to hel ...
SENIOR ENGINEER FULL STACK DEV
Role Summary We are looking for Full Stack Developers with strong backend expertise in Java and mandatory hands-on experience in Cloud (AWS or Azure). The role involves end-to-end development and cloud deployment of enterprise applications. Mandatory Technical Skills Candidate ...
Software Engineer Full Stack Java
Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world depends on every day. So why work at Kyndryl? We are always moving forward – always pushing ourselves to go further in our efforts to build a more equitable, inclusive world for ou ...
Invoyz Full Stack Software Development
Job Title: Senior Software Developer [Full Stack] Location: Bengaluru About Company: Invoyz Financial Solutions Pvt. Ltd. is a Bengaluru based financial services technology start-up with a fo ...
Sr. Software Engineer, Full stack
Job Overview We’re looking for a Senior software developer to join our development team working on developing our core products. You’ll work with a manager and software development team on several features of our products and be involved in the concept-to-delivery of high-quality solutions. ...
Full Stack Developer (Node.js & React.js)
Job SummarySynechron is seeking a skilled Full Stack Developer with extensive experience in Node.js and React.js to support the development of scalable, high-performance enterprise applications. This role involves designing, developing, and maintaining robust front-end and back-end systems, integr ...
Full stack developer with Angular
We are hiring a Full Stack Java Developer with 5+ years of experience in designing and developing scalable web applications. The candidate should have strong expertise in Java, Spring Boot, Microservices, and REST API development. The ideal candidate must have hands-on experience in backend development usi ...
Full Stack Developer Power Platform
Job SummaryThe Power Platform Developer will be responsible for designing, developing, and deploying business applications using Microsoft Power Apps, Power Automate, and Power BI. The role involves building Canvas and Model-Driven apps, automating business workflows, integr ...
Senior Full Stack Engineer ID69278
Job DescriptionAgileEngine is an Inc. 5000 company that creates award-winning software for Fortune 500 brands and trailblazing startups across 17+ industries. We rank among the leaders in areas like application development and AI/ML, and our people-first culture has earned us ...
Raven: Full stack Engineer Role
Raven is a YC-backed startup (S22) building AI assistants for manufacturing plants. We're taking decades of manufacturing expertise and combining it with AI to solve real operational problems. Backed by top VCs, we're a small, focused team working to make industrial operations safer, smarter, and more efficie ...
Lead Consultant, Full Stack Developer
Ready to build the future with AI? At Genpact, we don’t just keep up with technology—we set the pace. AI and digital innovation are redefining industries, and we’re leading the charge. Genpact’s AI Gigafactory, our industry-first accelerator, is an example of how we’re scaling advanced technology solutions to ...
Senior Software Engineer Full Stack
Company Overview Docusign brings agreements to life. Over 1.5 million customers and more than a billion people in over 180 countries use Docusign solutions to accelerate the process of doing business and simplify people’s lives. With intelligent agreement management, Docusign unleashes business-critical data tha ...
Senior Full Stack Engineer ID69278
AgileEngine is an Inc. 5000 company that creates award-winning software for Fortune 500 brands and trailblazing startups across 17+ industries. We rank among the leaders in areas like application development and AI/ML, and our people-first culture has earned us multiple Best Place to Wor ...
Senior Developer ReactJS Full stack
Location: Bangalore out ring road, 3 days mandatory work from office at client locationExperience Range 6 - 10 YearsJob Type: 6 months contract + ext Need Immediate joiners only Jo ...
Full stack developer with Angular
We are hiring a Full Stack Java Developer with 5+ years of experience in designing and developing scalable web applications. The candidate should have strong expertise in Java, Spring Boot, Microservices, and REST API development. The ideal candidate must have hands-on experience in back ...
Java Full Stack Developer Manager
Who we are looking for:As a Senior Lead Developer, the candidate will be responsible for designing and developing solutions for GTS Integration Services team. The candidate must have 10+ years of experience in developing web applications in Java, JavaScript frameworks, Spring MVC and Microservic ...
Full Stack Software Development Engineer
Job Description: We are seeking a talented Full Stack Software Development Engineer (SDE-1) to join our dynamic team. You will collaborate with cross-functional teams to deliver high-quality software solutions that meet our customers' needs. Responsibilities: Strong knowledge and experience on server-side develo ...
Principal Full Stack AI Engineer
We are hiring for a Senior Full-Stack Engineer (Front-End Leaning) with strong AI/agentic building experience to help completely rebuild and scale a human-blended AI coaching platform, and the role focuses on driving a complete architectural overhaul.The ideal candidate possesses a high level of agency ...
Full Stack Automation Test Developer
About the Role:We are looking for an experienced Senior QA Automation Engineer (Playwright with Typescript / JavaScript) to join our engineering team. The ideal candidate will be instrumental in building scalable automation frameworks, enhancing test coverage, and ensuring high-quality software deliver ...
Full Stack Software Engineer (.NET)
Greetings,TCS is looking for .Net Full stack DeveloperExperience: 6 to 15 yearsEducation: Minimum 15 years of fulltime education (10th, 12th and Graduation)Location: Bangalore/Chennai<strong ...
Senior Full Stack Developer PHP
About the company Lexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success. Lexitas offers an array of services in ...
Full Stack AI Systems Engineer
Job Title: Senior GenAI Full Stack EngineerLocation: Hybrid- BengaluruEmployment Type: Full-Time With VDart DigitalWe are seeking a Senior GenAI Full Stack Engineer to design, build, and deploy advanced Agentic AI systems for ...
Principal Full Stack AI Engineer
We are hiring for a Senior Full-Stack Engineer (Front-End Leaning) with strong AI/agentic building experience to help completely rebuild and scale a human-blended AI coaching platform, and the role focuses on driving a complete architectural overhaul.The ideal candidate possesses a high level of agency ...
Staff Engineer, (Java Full stack)
This job is with Danaher, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Bring more to life.Are you ready to accelerate your potential and make a real difference within life sciences, diagno ...
Senior Technical Lead(Full Stack)
About TaglynkAt Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we conne ...
Full Stack Engineer (AI-Native Builder)Experience: 7–12 yrs (flexible for demonstrated shipping velocity)This is a 5-day on-site role from HSR, BengaluruImmediate joiners preferredKindly do not ...
Senior full stack developer php
About the companyLexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success.Lexitas offers an array of services including local and national c ...
Senior Full Stack Developer PHP
About the company Lexitas is a high growth company. The Company is built on a belief that having strong personal relationships with our clients, and providing reliable, accurate and professional services is the driving force of our success. Lexitas offers an array of services ...
Software Engineer Full Stack Development
This job is with Kyndryl, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world d ...
Software Engineer Full Stack Java
This job is with Kyndryl, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world d ...
Senior Technical Lead(Full Stack)
About Taglynk At Taglynk, we are a leading talent acquisition and management consulting firm. We partner with fast-growing startups, SMEs, and industry pioneers to build dream teams that scale businesses from 0 to 1 and beyond. Our focus is on precision and excellence, ensuring we connect world ...
Senior Full Stack Software Engineer
Software Development Engineer 2 This role involves developing scalable backend systems using Go, Python, and Node.Js, and crafting responsive frontends with Flutter and React.Js. The ideal candidate will have experience in CI/CD pipelines and deploying applications to the Play Store an ...
Full Stack Adjacent Backend Developer
I’m Hiring a Backend Engineer (Top 10% Only) Location: Bangalore (On-site) Experience: 2–6 YearsI run ClearStack. We build serious, scalable systems for global clients. We move fast. We ship often. We fix what breaks. No politics. No passenge ...
Associate Full Stack Engineer (AWS)
AWS Full Stack SDE (Mid/Junior Level) Location: Hyderabad (Work from Office) Employment Type: Full-Time Experience: 2–6 YearsRole OverviewWe are hiring AWS Full Stack Software Development Engineers (SDEs) to work on enterpri ...
Software Engineer Full Stack Development
This job is with Kyndryl, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Who We AreAt Kyndryl, we design, build, manage and modernize the mission-critical technology systems that the world d ...
Principal Java Full Stack Engineer
Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benefits, data and resources they need to feel their best. Here, you will fin ...
Software Engineer Full Stack Development
Who We AreAt Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a las ...
Senior Engineer (Full stack), Monitoring
Postman is the world’s leading API platform, used by more than 30 million developers and 500,000 organizations, including 98% of the Fortune 500. Postman is helping developers and professionals across the globe build the API-first world by simplifying each step of the API lifecycle and streamlining collabora ...
Fold Health Full Stack Developer
Job Title: Full Stack Developer Experience: 3+ years Location: Pune (Amar Tech Park, Balewadi, Pune) – Full-time, On-site Domain: Healthcare (Preferred) ______________ About Fold Health ...
Full Stack Developer Internship Unpaid
Full-Stack Developer Internship Location: Bengaluru Employment Type: Internship (3-6 months) Experience Level: Entry-Level/Recent Graduate <sp ...
Sr. Software Engineer Full Stack
{railsEnv:production,inMailer:false,i18nLocale:en,i18nDefaultLocale:en,rorVersion:13.0.2,rorPro:false,href: ...
Senior Applications Developer (Full Stack)
Seeking a highly skilled Senior Full Stack Developer with 12–15 years of experience building secure, scalable enterprise web applications. The ideal candidate is an expert in ASP.NET Core, MVC, C#, .NET Framework, and modern front end development using HTML, CSS, JavaScript, TypeScript, Vue.js, Pinia, Vite, a ...
Principal Engineer Java Full Stack
HARMAN’s engineers and designers are creative, purposeful and agile. As part of this team, you’ll combine your technical expertise with innovative ideas to help drive cutting-edge solutions in the car, enterprise and connected ecosystem. Every day, you will push the boundaries of creative design, and HA ...
Staff Engineer .Net Full Stack
Company SummaryFirst American (India) is a GCC (Global Capability Center) of the First American Financial Corporation (NYSE: FAF) family of companies. FAI is a proud member of the FORTUNE 500 companies and has been amongst the Fortune 100 Best Companies to Work For® list for eight consecut ...
ZoomInfo is where careers accelerate. We move fast, think boldly, and empower you to do the best work of your life. You’ll be surrounded by teammates who care deeply, challenge each other, and celebrate wins. With tools that amplify your impact and a culture that backs your ambition, you won’t just contribute ...
Full stack developer with Angular
Job DescriptionWe are hiring a Full Stack Java Developer with 5+ years of experience in designing and developing scalable web applications. The candidate should have strong expertise in Java, Spring Boot, Microservices, and REST API development. The ideal candidate must have h ...
Senior Developer ReactJS Full stack
Greetings from ALIQAN Technologies!!!We are hiring a Senior Developer - ReactJS Full stack for one of our clients' MNCs.Location: Bangalore out ring road, 3 days mandatory work from office at client location ...
.Net Angular Full Stack developer
Our storyAt Alight, we believe a company’s success starts with its people. At our core, we Champion People, help our colleagues Grow with Purpose and true to our name we encourage colleagues to “Be Alight.”Our Values:Champion People – be empathetic and help create a p ...
Stand out from thousands of applicants. Use our proven career tools to optimize your applications and land your dream job faster.
Organize your job search and personal tasks. All data is confidential.
Open Planner →Access your confidential wellness report and resources to manage job search stress.
Check Wellbeing →Plan your skill development with O*NET support to stay competitive in your field.
Start Coaching →Get AI-powered suggestions on what to wear for your next interview.
Find Outfit →Plan your finances with our calculator, updated for 2025 tax regulations.
Calculate Tax →Get accurate, AI-supported salary trends to know your worth and negotiate better.
Check Salaries →Practice for any interview with AI-enabled Q&A sessions. All data is private.
Start Practicing →Use our AI-supported tool to predict potential interview questions based on your resume.
Predict Questions →Use our mock interview trainer to perfect your answers under timed conditions.
Start Timer →Ace tricky behavioral interviews with our AI-powered practice module.
Master Answers →Confidentially record interview questions you were asked for future reference.
Open Journal →A comprehensive tool to help you master every aspect of your interviews.
Become an Ace →Confidentially track your answers to common questions and refine them over time.
View Logs →Schedule and organize your job applications in one confidential planner.
Open Planner →Create perfect, tailored cover letters for each application with AI support.
Generate Letter →Get instant feedback on your resume with our NLP-supported analysis tool.
Check My Score →Check your resume's compatibility with Applicant Tracking Systems (ATS).
Check ATS Score →Use AI to analyze job descriptions and optimize your application materials.
Analyze Application →Confidentially plan and visualize your long-term career path and goals.
Visualize My Career →Get intelligent insights and strategies to confidently negotiate job offers.
Negotiate Offers →Track your entire job search progress from application to offer with this intelligent tool.
Track My Flow →Our intelligent matching engine that provides smart job recommendations.
Get Smart Matches →Tools to build and manage your professional connections. All data is confidential.
Build Network →A classic, O*NET supported template for corporate and professional roles.
Use This Template →A premium, O*NET supported template designed for senior and C-level positions.
Use This Template →A fresh, stylish, O*NET supported template perfect for tech and modern industries.
Use This Template →A visually distinct, O*NET supported template for design and artistic roles.
Use This Template →A clean, simple, O*NET supported template that focuses purely on content.
Use This Template →The standard European Union recommended format for wide compatibility.
Use This Template →An institution-recommended template perfect for internships and first jobs.
Use This Template →An institution-recommended template for recent graduates entering the workforce.
Use This Template →The researcher-recommended format for roles in academia and research.
Use This Template →A tech-savvy recommended template to highlight your technical skills.
Use This Template →A trades-recommended template to showcase hands-on skills and experience.
Use This Template →A sleek, black-and-white, O*NET supported template for a professional look.
Use This Template →An artist-recommended template that allows your creativity to shine.
Use This Template →A researcher-recommended template based on the classic Harvard format.
Use This Template →Help us improve our platform by joining our community research program.
Join Research →Share your experience with our tools to help other job seekers.
Share Experience →Create your free account to save jobs, build your profile, and track applications.
Create Account →Access your dashboard, manage applications, and continue your job search.
Access Your Account →Create a comprehensive professional profile that attracts recruiters and showcases your skills.
Build Your Profile →See your public profile exactly as employers will see it. Make sure it's perfect.
Preview Profile →Keep track of all your saved job opportunities in one organized place.
View Saved Jobs →View and manage all the company reviews you've submitted.
See Your Reviews →Manage the list of companies you follow to stay updated on their new openings.
Manage Following →Discover and research top employers in your country and industry.
Discover Employers →Use our O*NET supported CV builder to create a professional resume from scratch.
Build Your CV →Convert your PDF resumes or documents into editable Word (DOC) format.
Convert PDF →Create universally compatible PDF documents from your Word (DOC) files.
Create PDF →Find answers to common questions about our job site and platform.
Read FAQ →Get help and find answers to questions specifically for job seekers.
Get Help →Learn about the technology and algorithms behind how we match you to jobs.
Learn How →Discover how we use your profile and activity to provide customized job suggestions.
Learn More →Understand our fast application process and how to make the most of it.
Learn More →Learn how to manage your job alert settings so you get the updates you want.
Manage Settings →A complete guide to understanding how job alerts work and how to use them effectively.
Read Guide →Learn how our system matches your resume to job requirements.
Learn More →Read our guide to building a professional and ethical personal brand.
Read Guide →Learn how to increase your visibility to recruiters on our platform.
Increase Visibility →Find out how you can get a verified badge to build trust with employers.
Get Verified →Learn about the advanced AI and ATS technology that powers our platform.
Learn More →Understand how Applicant Tracking Systems rank you as an applicant.
Learn More →Learn how our AI-powered semantic matching goes beyond keywords.
Learn More →Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights
Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph uses a vertical bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each vertical bar represents a different job category, with the size of the vertical bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph uses a funnel chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the funnel represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,657,784+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
There are popular job portals and recruitment agencies active in India. India Jobs Expertini is one of the major portals that can help you find the right job. Expertini.Com can assist you in accessing a wide range of job listings and professional opportunities, in addition to its free CV Builder, Resume Score, and Job Alert tools.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.