964,811+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

Professional job seekers finding India jobs through Expertini
750,000+ professionals on Expertini 750,000+ Candidates
Join our global community
Expertini Penguin Mascot Resume Score™
Resume Score™ Instantly
Upload Your CV
Quick 30-second process

Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.

Reset

Create Job Alert

 
   
Reset

Full Stack Developer (Exp 2 6 Years)

Job description Working knowledge in CMS platforms like WordPress, Drupal is must and expert knowledge of Bootstrap framework, HTML5, CSS3 and Sass /LESS. Excellent Angular 7, HTML5, CSS 3, C# and JavaScript knowledge of front-end development tools and processes. H ...

Full stack Python Developer (FE+BE+Serverless)

We are seeking a Full Stack Python Developer with strong experience in both frontend and backend development, and deep familiarity with Azure Cloud and serverless architecture. In this full-time role, you’ll build modern, scalable web applications and services using Python, JavaScript frameworks, and Azure-nativ ...

Sr Lead, SW Full Stack Eng Cloud

About Northern Trust: Northern Trust, a Fortune 500 company, is a globally recognized, award-winning financial institution that has been in continuous operation since 1889. Northern Trust is proud to provide innovative financial services and guidance to the world’s most successful indivi ...

SCADEA JAVA FULL STACK DEVELOPER WITH ANGULAR

Requirement: Java Full Stack Developer ( Angular- 2+ years atleast) Location: Pune, Chennai Experience: 8+ Years Scadea Payroll, End Client Citi Bank ...

Senior Software Engineer (Java Full Stack, React.js)

Description We are currently seeking a highly skilled and motivated Senior Software Engineer with expertise in Java Full Stack and React JS to join our dynamic team. As a Senior Engineer, you will play a crucial role in the design, development, and optimization of scalable and h ...

Senior Software Engineer Java Full Stack Angular

Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with m ...

Full Stack Developer (React, Node.js, NoSQL, SQL)

Job Description Full Stack Developer (React, Node.js, NoSQL, SQL) – Table-Side Food Ordering App Timings : 04:30PM- 12:30AM Location : Hyderabad (Work from office) Notice : Immediately available This is a co ...

Senior Full Stack (React + Python ) Developer Role

It's fun to work in a company where people truly BELIEVE in what they are doing! If you like wild growth and working with happy, enthusiastic over-achievers, you'll enjoy your career with us! Hiring Related Queries This inbox does not process resume submissions. Al ...

Full Stack Web Developer (Python | React | MySQL)

Full Stack Web Developer (Python | React | MySQL) Are you passionate about building scalable web applications and experimenting with cutting-edge coding techniques like Vibe Coding (Claude Code)? We're looking for a talented Full Stack Developer to join our dynamic team at Birlasoft. </p ...

Senior Java Full Stack Engineer – Capital Markets

Description We’re looking for a Senior Full Stack Engineer to build high performance, cloud native systems. This role blends strong backend engineering with Java/Spring, front end development with React, and modern DevOps practices across Azure. Technical Skills (Must Have) < ...

Full Stack Development(Python Fast API,ReactJS)

Date Posted: Country: IndiaLocation: IN-KA-BENGALURU-NORTHGATE ~ Sy No 2/2 Venkatala Village ~ SY NO 2/2 VENKATALA VILLAGE, Yelahanka HobliPosition Role Type: OnsitePlease NOTE: WE are looking only for Immediate Joiners At RTX, the wo ...

Full stack Python Developer (FE+BE+Serverless)

We are seeking a Full Stack Python Developer with strong experience in both frontend and backend development, and deep familiarity with Azure Cloud and serverless architecture. In this full-time role, you’ll build modern, scalable web applications and services using Python, JavaScript frameworks, and Azure-nativ ...

Full Stack Developer (React, Node.js, NoSQL, SQL)

Job Description Full Stack Developer (React, Node.js, NoSQL, SQL) – Table-Side Food Ordering App Timings : 04:30PM- 12:30AM Location : Hyderabad (Work from office) Notice : Immediately available This is a co ...

Medior Full Stack Developer (Python Backend Focus)

Xenon7 is on the lookout for a talented Medior Full-Stack Developer with a strong focus on Python backend development to join our dynamic team. In this role, you will be responsible for designing, developing, and maintaining both front-end and back-end systems for our innovative web applications. You will col ...

Software Engineer Full Stack Java, React Engineer

The Digital S/W Engineer Intmd Analyst is a seasoned professional role. Applies in-depth disciplinary knowledge, contributing to the development of new techniques and the improvement of processes and workflow for the area or function. We are looking for experienced full-stack software engineers who are ...

AI/ML Engineer AIML, Java Full Stack

Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benefits, data and resources they need to feel their best. Here, you will fin ...

SAP Full Stack Developer (CAPM / Fiori / UI5)

Company Description Aqilea is an IT and engineering consulting partner that helps companies get more out of their technology and operations. With teams in Stockholm and Bangalore, we work closely with our clients to build solutions that fit their needs - from software development, AI ...

Java Full Stack Developer – Angular + Azure Services

Job Description Java Full Stack Developer – Angular + Azure Service s Location: Chennai Interview Date: 23-May-2026 Mode: Face-to-Face Requirements Mandatory Skills: ✔ Java < ...

Senior Full Stack Engineer (Hybrid) Bengalore, India

Job Logistics Summary: Position: Full Stack Engineer Type: Full-Time (Hybrid) Location: India, Bengaluru Who We Are: SellCord is the largest Walmart-exclusive agency dedicated to he ...

.NET Full Stack Developer – Angular/React + Azure

Hiring Alert | .NET Full Stack Developer – Angular/React + Azure Location: Chennai, Hyderabad, Noida, Pune, Kochi Interview Date: 23-May-2026 Mode: Face-to-Face Requirements Mandatory Skills: .NET Core / ASP.NET MVC </l ...

Java Full Stack Developer (Vue 3 Expert)

Job Description Hiring: Java Full Stack Developer (Vue 3 Expert) Location: PAN India (Remote) Salary: Up to 40 LPA Experience: 7–10 Years We are hiring a highly skilled Java Full Stack Developer with strong expertise in Vue 3 and enterprise-g ...

Principal Engineer ( Full Stack React, Java, AWS)

Position Overview Autodesk Platform Service and Emerging Technology (UDA) team is looking for Principal Engineer -full stack talents to develop a core AI powered component that to empower millions of customers to search for and access any of their Autodesk data from any desktop, ...

Java Full Stack Developer L3: 26 00832

Primary Skills: Java-Expert, Full Stack-Advanced, Spring Boot-Expert, Angular-Advanced, Cloud (IBM)-IntermediateContract Type: PermanentLocation: Chennai Job Summary: This position is for a Senior Full Stack Java Developer responsible for developing and managing applications fr ...

Lead Software Engineer Java Full Stack Developer

Are you ready to make an impact at DTCC? Do you want to work on innovative projects, collaborate with a dynamic and supportive team, and receive investment in your professional development? At DTCC, we are at the forefront of innovation in the financial markets. We are committed to helping ou ...

Senior Full Stack (React + Python ) Developer Role

It's fun to work in a company where people truly BELIEVE in what they are doing! If you like wild growth and working with happy, enthusiastic over-achievers, you'll enjoy your career with us! Hiring Related Queries This inbox does not process resume submissions. Al ...

Full Stack Python Developer (2 5 Years)

Technical RequirementsFront-End: Proficient in for building responsive and dynamic user interfaces. Knowledge of front-end tools and libraries (., Redux, Axios, or Styled Components) is a plus. Understanding of HTML, CSS, JavaScript, and responsive design principles.Back-End: Experience with one or more Python-b ...

MERN Full Stack developer CRM Integration Specialist

Senior Full Stack Engineer Mohali | Night Shift | 5 Days Working Job Overview We are hiring an experienced Full Stack Engineer with strong expertise in CRM Development, API Integrations, and Middleware Architecture. The candidate must have hands-on experience in building and integrati ...

Jr. Full Stack developer (Angular, Node js)

Experience: 5-7years Location: Chennai Workmode: Hybrid Roles and Responsibilities: Full Stack Engineers to build a large-scale, customer-facing web platform from scratch. Develop modern frontend applications using Angular and backend ...

Full Stack Developer (React, Node.js, NoSQL, SQL)

Job Description Full Stack Developer (React, Node.js, NoSQL, SQL) – Table-Side Food Ordering App Timings : 04:30PM- 12:30AM Location : Hyderabad (Work from office) Notice : Immediately available This is a co ...

Software Engineer – Full Stack (.Net/React/Oracle)

Description We are looking to hire a .Net Software Engineer, with excellent technical and communication skills, to effectively collaborate with IT and business stakeholders to understand their needs and develop functionality and enhancements for the robotic process automation work. In ...

Tech Lead (Polyglot Full Stack & Intelligent Systems)

Job Description Job Description – Tech Lead (Polyglot Full Stack & Intelligent Systems) We are seeking a highly capable Tech Lead with strong experience in full stack software development, cloud-native platforms, industrial system digitization, and intelligent softwar ...

Urgent Requirement For Full Stack Java Developer

About the Role:We are seeking an experienced Java Full Stack Developer with strong expertise in backend andfrontend technologies. The ideal candidate will be proficient in Java, Spring Boot, , and, and capable of delivering scalable, high-performance applications.Key Responsibilities:- Design, develop, and maint ...

Lead Software Engineer (Java Full Stack, React.JS)

Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with m ...

Java Full Stack Developer – Angular + Azure Services

Job Description Java Full Stack Developer – Angular + Azure Service s Location: Chennai Interview Date: 23-May-2026 Mode: Face-to-Face Requirements Mandatory Skills: ✔ Java < ...

Mobile Programming Full Stack Developer(.NET+React)

Role - Full Stack Developer Work Experience – 3-5 Yrs Location- Mumbai Key skills -.Netcore, Reactjs Skills • More than 2 years of working experience with .net core • More than 2 years of ...

Full Stack Engineer Climate & Packaging (m/f)

Description Are You Ready to Make It Happen at Mondelēz International? Join our Mission to Lead the Future of Snacking. Make It Uniquely Yours. You provide software and application knowledge to support implementation of the given solutions. Posit ...

Full Stack Engineer – Desktop Platform & Developer Experience

Job Title: Full-Stack Engineer Desktop Platform & Developer Experience Experience: 5+ Years Industry: Technology / AI Infrastructure / Developer Tools Location: Bangalore (Remote) JobType </st ...

Custom Software Engineer Java Full Stack Development

As a Custom Software Engineer, a typical day involves leading the design, construction, and configuration of software applications. We are looking for Senior Java Developer. This role requires taking ownership of the development process and serving as the main liaison for project-related communications. The posi ...

Advanced Engineer, Software Engineering Full Stack Development

HARMAN’s engineers and designers are creative, purposeful and agile. As part of this team, you’ll combine your technical expertise with innovative ideas to help drive cutting-edge solutions in the car, enterprise and connected ecosystem. Every day, you will push the boundaries of creative design, and HA ...

Java Full stack Developer and Testing Engineer

We are seeking a highly skilled and motivated Java Fullstack Developer with a strong background in automation testing to join our dynamic development team. The ideal candidate will be responsible for designing, developing, and maintaining robust, scalable, and high-performance applications from front to back, ...

Senior Full Stack WordPress Web Developer – India

About the role Navitas is seeking an innovative, and high-performing Senior Full-Stack WordPress Web Developer with significant front-end development experience, expertise in custom WordPress theme and plugin development, and advanced English language skills. The primary purpose of this ...

Tech Lead – Full Stack (AI First Mindset)

Job Description: Tech Lead – Full Stack (AI-First Mindset) Location: (Hybrid/Remote – India) Experience: 7–12+ years Role Type: Full-time About the Role As a Tech Lead (AI-F ...

Require a Full Stack Developer in Hyderabad

Job Description Execute core duties with precision and efficiency to support daily operations Collaborate with cross-functional teams to achieve shared objectives Maintain accurate records and ensure compliance with organizational policies Identi ...

Java Full Stack Developer (Spring boot + react)

Job Details Requirement Type Permanent Job Title Java Full Stack Developer (Spring boot + react) Job Level Middle Management Job Description No. of Openings 6 Job Domain IT Experience - Minimum - Maximum / ( regular), BCA, MSc Specialisation Skills Full Stack Java Developer, Backe ...

Software Engineer (.Net core full stack Angular)

Job Description Job Title: Software Engineer - .Net Full stack developer with Angular Work Location: Bengaluru, Karnataka, India Shifts any: 12.00pm to 9.00pm Work mode: Hybrid - 3 Days office Company Description <p ...

Lead Full Stack Developer (Node JS + Angular )

What’s important to us: We are seeking a Lead Full Stack Developer who will understand the need to achieve a balance between innovation and the most appropriate solution for our clients. One should be passionate about their work, eager to learn and grow, and who is committed to deliveri ...

AI Agent and full stack development internship

We’re a US based tech startup. We are looking for AI+Full stack developers. You’ll work on a real production system involving: Multi-agent workflows (Discovery, Deep Dive, Filters, Reports) Stateful AI systems with memory and context Real-world ...

Dot Net Full Stack (Associate and AVP)

Why Mizuho At Mizuho, we provide the stability of an international industry leader with the career trajectory of a growing business. Our steady, strategic growth gives our people at all levels rewarding degrees of responsibility and richer work experience than a boutique fi ...

Sde 3 + lead instructor full stack development

About Newton:Newton School of Technology (NST) is a new-age institution redefining technical education in India. Founded by IIT alumni, NST offers a 4-year B. Tech in Computer Science and AI, focused on hands-on learning and deep industry integration. Within two years, over 93% of students have secured paid ...

Dot net full stack (associate and avp)

Why MizuhoAt Mizuho, we provide the stability of an international industry leader with the career trajectory of a growing business. Our steady, strategic growth gives our people at all levels rewarding degrees of responsibility and richer work experience than a boutique firm or an established giant could off ...

🚀 Boost Your Hiring Chances with Our AI-Powered Tool-Kit

Stand out from thousands of applicants. Use our proven career tools to optimize your applications and land your dream job faster.

To-Do Planner

Organize your job search and personal tasks. All data is confidential.

Open Planner

Wellbeing Center

Access your confidential wellness report and resources to manage job search stress.

Check Wellbeing

Skill Coach

Plan your skill development with O*NET support to stay competitive in your field.

Start Coaching

Outfit Helper

Get AI-powered suggestions on what to wear for your next interview.

Find Outfit

Income Tax Calculator

Plan your finances with our calculator, updated for 2025 tax regulations.

Calculate Tax

Salary Benchmark

Get accurate, AI-supported salary trends to know your worth and negotiate better.

Check Salaries

Interview Practice

Practice for any interview with AI-enabled Q&A sessions. All data is private.

Start Practicing

Interview Predictor

Use our AI-supported tool to predict potential interview questions based on your resume.

Predict Questions

Interview Practice Timer

Use our mock interview trainer to perfect your answers under timed conditions.

Start Timer

Behavioral Mastery

Ace tricky behavioral interviews with our AI-powered practice module.

Master Answers

Question Journal

Confidentially record interview questions you were asked for future reference.

Open Journal

Interview Ace

A comprehensive tool to help you master every aspect of your interviews.

Become an Ace

Q&A Logs

Confidentially track your answers to common questions and refine them over time.

View Logs

Application Planner

Schedule and organize your job applications in one confidential planner.

Open Planner

Cover Letter Tool

Create perfect, tailored cover letters for each application with AI support.

Generate Letter

Resume Score

Get instant feedback on your resume with our NLP-supported analysis tool.

Check My Score

ATS Score

Check your resume's compatibility with Applicant Tracking Systems (ATS).

Check ATS Score

Application Analyzer

Use AI to analyze job descriptions and optimize your application materials.

Analyze Application

Career Visualizer

Confidentially plan and visualize your long-term career path and goals.

Visualize My Career

Offer Genius

Get intelligent insights and strategies to confidently negotiate job offers.

Negotiate Offers

JobFlow

Track your entire job search progress from application to offer with this intelligent tool.

Track My Flow

JobSense

Our intelligent matching engine that provides smart job recommendations.

Get Smart Matches

Networking Toolkit

Tools to build and manage your professional connections. All data is confidential.

Build Network

Professional CV

A classic, O*NET supported template for corporate and professional roles.

Use This Template

Executive CV

A premium, O*NET supported template designed for senior and C-level positions.

Use This Template

Modern CV

A fresh, stylish, O*NET supported template perfect for tech and modern industries.

Use This Template

Creative CV

A visually distinct, O*NET supported template for design and artistic roles.

Use This Template

Minimalist CV

A clean, simple, O*NET supported template that focuses purely on content.

Use This Template

Europass CV

The standard European Union recommended format for wide compatibility.

Use This Template

Student CV

An institution-recommended template perfect for internships and first jobs.

Use This Template

Graduate CV

An institution-recommended template for recent graduates entering the workforce.

Use This Template

Academic CV

The researcher-recommended format for roles in academia and research.

Use This Template

Developer/IT CV

A tech-savvy recommended template to highlight your technical skills.

Use This Template

Skilled Worker CV

A trades-recommended template to showcase hands-on skills and experience.

Use This Template

Monochrome CV

A sleek, black-and-white, O*NET supported template for a professional look.

Use This Template

Art CV

An artist-recommended template that allows your creativity to shine.

Use This Template

Harvard CV

A researcher-recommended template based on the classic Harvard format.

Use This Template

Volunteer Research

Help us improve our platform by joining our community research program.

Join Research

Review Us

Share your experience with our tools to help other job seekers.

Share Experience

Register

Create your free account to save jobs, build your profile, and track applications.

Create Account

Login

Access your dashboard, manage applications, and continue your job search.

Access Your Account

Profile Builder

Create a comprehensive professional profile that attracts recruiters and showcases your skills.

Build Your Profile

View Profile

See your public profile exactly as employers will see it. Make sure it's perfect.

Preview Profile

Bookmarked Jobs

Keep track of all your saved job opportunities in one organized place.

View Saved Jobs

Your Reviews

View and manage all the company reviews you've submitted.

See Your Reviews

Following

Manage the list of companies you follow to stay updated on their new openings.

Manage Following

Find Companies

Discover and research top employers in your country and industry.

Discover Employers

Standalone CV Builder

Use our O*NET supported CV builder to create a professional resume from scratch.

Build Your CV

PDF to DOC (Beta)

Convert your PDF resumes or documents into editable Word (DOC) format.

Convert PDF

DOC to PDF (Beta)

Create universally compatible PDF documents from your Word (DOC) files.

Create PDF

General FAQ

Find answers to common questions about our job site and platform.

Read FAQ

Job Seekers FAQ

Get help and find answers to questions specifically for job seekers.

Get Help

Job Matching

Learn about the technology and algorithms behind how we match you to jobs.

Learn How

Personalized Matching

Discover how we use your profile and activity to provide customized job suggestions.

Learn More

Quick Apply

Understand our fast application process and how to make the most of it.

Learn More

Alert Frequency

Learn how to manage your job alert settings so you get the updates you want.

Manage Settings

Job Alerts Guide

A complete guide to understanding how job alerts work and how to use them effectively.

Read Guide

Resume Matching

Learn how our system matches your resume to job requirements.

Learn More

Ethical Branding

Read our guide to building a professional and ethical personal brand.

Read Guide

Candidate Visibility

Learn how to increase your visibility to recruiters on our platform.

Increase Visibility

Verified Badge

Find out how you can get a verified badge to build trust with employers.

Get Verified

AI ATS Technology

Learn about the advanced AI and ATS technology that powers our platform.

Learn More

ATS Ranking

Understand how Applicant Tracking Systems rank you as an applicant.

Learn More

Semantic Matching

Learn how our AI-powered semantic matching goes beyond keywords.

Learn More

    Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights