Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.
Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.
Full Stack Developer (Exp 2 6 Years)
Job description Working knowledge in CMS platforms like WordPress, Drupal is must and expert knowledge of Bootstrap framework, HTML5, CSS3 and Sass /LESS. Excellent Angular 7, HTML5, CSS 3, C# and JavaScript knowledge of front-end development tools and processes. H ...
Full stack Python Developer (FE+BE+Serverless)
We are seeking a Full Stack Python Developer with strong experience in both frontend and backend development, and deep familiarity with Azure Cloud and serverless architecture. In this full-time role, you’ll build modern, scalable web applications and services using Python, JavaScript frameworks, and Azure-nativ ...
Sr Lead, SW Full Stack Eng Cloud
About Northern Trust: Northern Trust, a Fortune 500 company, is a globally recognized, award-winning financial institution that has been in continuous operation since 1889. Northern Trust is proud to provide innovative financial services and guidance to the world’s most successful indivi ...
SCADEA JAVA FULL STACK DEVELOPER WITH ANGULAR
Requirement: Java Full Stack Developer ( Angular- 2+ years atleast) Location: Pune, Chennai Experience: 8+ Years Scadea Payroll, End Client Citi Bank ...
Senior Software Engineer (Java Full Stack, React.js)
Description We are currently seeking a highly skilled and motivated Senior Software Engineer with expertise in Java Full Stack and React JS to join our dynamic team. As a Senior Engineer, you will play a crucial role in the design, development, and optimization of scalable and h ...
Senior Software Engineer Java Full Stack Angular
Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with m ...
Full Stack Developer (React, Node.js, NoSQL, SQL)
Job Description Full Stack Developer (React, Node.js, NoSQL, SQL) – Table-Side Food Ordering App Timings : 04:30PM- 12:30AM Location : Hyderabad (Work from office) Notice : Immediately available This is a co ...
Senior Full Stack (React + Python ) Developer Role
It's fun to work in a company where people truly BELIEVE in what they are doing! If you like wild growth and working with happy, enthusiastic over-achievers, you'll enjoy your career with us! Hiring Related Queries This inbox does not process resume submissions. Al ...
Full Stack Web Developer (Python | React | MySQL)
Full Stack Web Developer (Python | React | MySQL) Are you passionate about building scalable web applications and experimenting with cutting-edge coding techniques like Vibe Coding (Claude Code)? We're looking for a talented Full Stack Developer to join our dynamic team at Birlasoft. </p ...
Senior Java Full Stack Engineer – Capital Markets
Description We’re looking for a Senior Full Stack Engineer to build high performance, cloud native systems. This role blends strong backend engineering with Java/Spring, front end development with React, and modern DevOps practices across Azure. Technical Skills (Must Have) < ...
Full Stack Development(Python Fast API,ReactJS)
Date Posted: Country: IndiaLocation: IN-KA-BENGALURU-NORTHGATE ~ Sy No 2/2 Venkatala Village ~ SY NO 2/2 VENKATALA VILLAGE, Yelahanka HobliPosition Role Type: OnsitePlease NOTE: WE are looking only for Immediate Joiners At RTX, the wo ...
Full stack Python Developer (FE+BE+Serverless)
We are seeking a Full Stack Python Developer with strong experience in both frontend and backend development, and deep familiarity with Azure Cloud and serverless architecture. In this full-time role, you’ll build modern, scalable web applications and services using Python, JavaScript frameworks, and Azure-nativ ...
Full Stack Developer (React, Node.js, NoSQL, SQL)
Job Description Full Stack Developer (React, Node.js, NoSQL, SQL) – Table-Side Food Ordering App Timings : 04:30PM- 12:30AM Location : Hyderabad (Work from office) Notice : Immediately available This is a co ...
Medior Full Stack Developer (Python Backend Focus)
Xenon7 is on the lookout for a talented Medior Full-Stack Developer with a strong focus on Python backend development to join our dynamic team. In this role, you will be responsible for designing, developing, and maintaining both front-end and back-end systems for our innovative web applications. You will col ...
Software Engineer Full Stack Java, React Engineer
The Digital S/W Engineer Intmd Analyst is a seasoned professional role. Applies in-depth disciplinary knowledge, contributing to the development of new techniques and the improvement of processes and workflow for the area or function. We are looking for experienced full-stack software engineers who are ...
AI/ML Engineer AIML, Java Full Stack
Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benefits, data and resources they need to feel their best. Here, you will fin ...
SAP Full Stack Developer (CAPM / Fiori / UI5)
Company Description Aqilea is an IT and engineering consulting partner that helps companies get more out of their technology and operations. With teams in Stockholm and Bangalore, we work closely with our clients to build solutions that fit their needs - from software development, AI ...
Java Full Stack Developer – Angular + Azure Services
Job Description Java Full Stack Developer – Angular + Azure Service s Location: Chennai Interview Date: 23-May-2026 Mode: Face-to-Face Requirements Mandatory Skills: ✔ Java < ...
Senior Full Stack Engineer (Hybrid) Bengalore, India
Job Logistics Summary: Position: Full Stack Engineer Type: Full-Time (Hybrid) Location: India, Bengaluru Who We Are: SellCord is the largest Walmart-exclusive agency dedicated to he ...
.NET Full Stack Developer – Angular/React + Azure
Hiring Alert | .NET Full Stack Developer – Angular/React + Azure Location: Chennai, Hyderabad, Noida, Pune, Kochi Interview Date: 23-May-2026 Mode: Face-to-Face Requirements Mandatory Skills: .NET Core / ASP.NET MVC </l ...
Java Full Stack Developer (Vue 3 Expert)
Job Description Hiring: Java Full Stack Developer (Vue 3 Expert) Location: PAN India (Remote) Salary: Up to 40 LPA Experience: 7–10 Years We are hiring a highly skilled Java Full Stack Developer with strong expertise in Vue 3 and enterprise-g ...
Principal Engineer ( Full Stack React, Java, AWS)
Position Overview Autodesk Platform Service and Emerging Technology (UDA) team is looking for Principal Engineer -full stack talents to develop a core AI powered component that to empower millions of customers to search for and access any of their Autodesk data from any desktop, ...
Java Full Stack Developer L3: 26 00832
Primary Skills: Java-Expert, Full Stack-Advanced, Spring Boot-Expert, Angular-Advanced, Cloud (IBM)-IntermediateContract Type: PermanentLocation: Chennai Job Summary: This position is for a Senior Full Stack Java Developer responsible for developing and managing applications fr ...
Lead Software Engineer Java Full Stack Developer
Are you ready to make an impact at DTCC? Do you want to work on innovative projects, collaborate with a dynamic and supportive team, and receive investment in your professional development? At DTCC, we are at the forefront of innovation in the financial markets. We are committed to helping ou ...
Senior Full Stack (React + Python ) Developer Role
It's fun to work in a company where people truly BELIEVE in what they are doing! If you like wild growth and working with happy, enthusiastic over-achievers, you'll enjoy your career with us! Hiring Related Queries This inbox does not process resume submissions. Al ...
Full Stack Python Developer (2 5 Years)
Technical RequirementsFront-End: Proficient in for building responsive and dynamic user interfaces. Knowledge of front-end tools and libraries (., Redux, Axios, or Styled Components) is a plus. Understanding of HTML, CSS, JavaScript, and responsive design principles.Back-End: Experience with one or more Python-b ...
MERN Full Stack developer CRM Integration Specialist
Senior Full Stack Engineer Mohali | Night Shift | 5 Days Working Job Overview We are hiring an experienced Full Stack Engineer with strong expertise in CRM Development, API Integrations, and Middleware Architecture. The candidate must have hands-on experience in building and integrati ...
Jr. Full Stack developer (Angular, Node js)
Experience: 5-7years Location: Chennai Workmode: Hybrid Roles and Responsibilities: Full Stack Engineers to build a large-scale, customer-facing web platform from scratch. Develop modern frontend applications using Angular and backend ...
Full Stack Developer (React, Node.js, NoSQL, SQL)
Job Description Full Stack Developer (React, Node.js, NoSQL, SQL) – Table-Side Food Ordering App Timings : 04:30PM- 12:30AM Location : Hyderabad (Work from office) Notice : Immediately available This is a co ...
Software Engineer – Full Stack (.Net/React/Oracle)
Description We are looking to hire a .Net Software Engineer, with excellent technical and communication skills, to effectively collaborate with IT and business stakeholders to understand their needs and develop functionality and enhancements for the robotic process automation work. In ...
Tech Lead (Polyglot Full Stack & Intelligent Systems)
Job Description Job Description – Tech Lead (Polyglot Full Stack & Intelligent Systems) We are seeking a highly capable Tech Lead with strong experience in full stack software development, cloud-native platforms, industrial system digitization, and intelligent softwar ...
Urgent Requirement For Full Stack Java Developer
About the Role:We are seeking an experienced Java Full Stack Developer with strong expertise in backend andfrontend technologies. The ideal candidate will be proficient in Java, Spring Boot, , and, and capable of delivering scalable, high-performance applications.Key Responsibilities:- Design, develop, and maint ...
Lead Software Engineer (Java Full Stack, React.JS)
Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with m ...
Java Full Stack Developer – Angular + Azure Services
Job Description Java Full Stack Developer – Angular + Azure Service s Location: Chennai Interview Date: 23-May-2026 Mode: Face-to-Face Requirements Mandatory Skills: ✔ Java < ...
Mobile Programming Full Stack Developer(.NET+React)
Role - Full Stack Developer Work Experience – 3-5 Yrs Location- Mumbai Key skills -.Netcore, Reactjs Skills • More than 2 years of working experience with .net core • More than 2 years of ...
Full Stack Engineer Climate & Packaging (m/f)
Description Are You Ready to Make It Happen at Mondelēz International? Join our Mission to Lead the Future of Snacking. Make It Uniquely Yours. You provide software and application knowledge to support implementation of the given solutions. Posit ...
Full Stack Engineer – Desktop Platform & Developer Experience
Job Title: Full-Stack Engineer Desktop Platform & Developer Experience Experience: 5+ Years Industry: Technology / AI Infrastructure / Developer Tools Location: Bangalore (Remote) JobType </st ...
Custom Software Engineer Java Full Stack Development
As a Custom Software Engineer, a typical day involves leading the design, construction, and configuration of software applications. We are looking for Senior Java Developer. This role requires taking ownership of the development process and serving as the main liaison for project-related communications. The posi ...
Advanced Engineer, Software Engineering Full Stack Development
HARMAN’s engineers and designers are creative, purposeful and agile. As part of this team, you’ll combine your technical expertise with innovative ideas to help drive cutting-edge solutions in the car, enterprise and connected ecosystem. Every day, you will push the boundaries of creative design, and HA ...
Java Full stack Developer and Testing Engineer
We are seeking a highly skilled and motivated Java Fullstack Developer with a strong background in automation testing to join our dynamic development team. The ideal candidate will be responsible for designing, developing, and maintaining robust, scalable, and high-performance applications from front to back, ...
Senior Full Stack WordPress Web Developer – India
About the role Navitas is seeking an innovative, and high-performing Senior Full-Stack WordPress Web Developer with significant front-end development experience, expertise in custom WordPress theme and plugin development, and advanced English language skills. The primary purpose of this ...
Tech Lead – Full Stack (AI First Mindset)
Job Description: Tech Lead – Full Stack (AI-First Mindset) Location: (Hybrid/Remote – India) Experience: 7–12+ years Role Type: Full-time About the Role As a Tech Lead (AI-F ...
Require a Full Stack Developer in Hyderabad
Job Description Execute core duties with precision and efficiency to support daily operations Collaborate with cross-functional teams to achieve shared objectives Maintain accurate records and ensure compliance with organizational policies Identi ...
Java Full Stack Developer (Spring boot + react)
Job Details Requirement Type Permanent Job Title Java Full Stack Developer (Spring boot + react) Job Level Middle Management Job Description No. of Openings 6 Job Domain IT Experience - Minimum - Maximum / ( regular), BCA, MSc Specialisation Skills Full Stack Java Developer, Backe ...
Software Engineer (.Net core full stack Angular)
Job Description Job Title: Software Engineer - .Net Full stack developer with Angular Work Location: Bengaluru, Karnataka, India Shifts any: 12.00pm to 9.00pm Work mode: Hybrid - 3 Days office Company Description <p ...
Lead Full Stack Developer (Node JS + Angular )
What’s important to us: We are seeking a Lead Full Stack Developer who will understand the need to achieve a balance between innovation and the most appropriate solution for our clients. One should be passionate about their work, eager to learn and grow, and who is committed to deliveri ...
AI Agent and full stack development internship
We’re a US based tech startup. We are looking for AI+Full stack developers. You’ll work on a real production system involving: Multi-agent workflows (Discovery, Deep Dive, Filters, Reports) Stateful AI systems with memory and context Real-world ...
Dot Net Full Stack (Associate and AVP)
Why Mizuho At Mizuho, we provide the stability of an international industry leader with the career trajectory of a growing business. Our steady, strategic growth gives our people at all levels rewarding degrees of responsibility and richer work experience than a boutique fi ...
Sde 3 + lead instructor full stack development
About Newton:Newton School of Technology (NST) is a new-age institution redefining technical education in India. Founded by IIT alumni, NST offers a 4-year B. Tech in Computer Science and AI, focused on hands-on learning and deep industry integration. Within two years, over 93% of students have secured paid ...
Dot net full stack (associate and avp)
Why MizuhoAt Mizuho, we provide the stability of an international industry leader with the career trajectory of a growing business. Our steady, strategic growth gives our people at all levels rewarding degrees of responsibility and richer work experience than a boutique firm or an established giant could off ...
Stand out from thousands of applicants. Use our proven career tools to optimize your applications and land your dream job faster.
Organize your job search and personal tasks. All data is confidential.
Open Planner →Access your confidential wellness report and resources to manage job search stress.
Check Wellbeing →Plan your skill development with O*NET support to stay competitive in your field.
Start Coaching →Get AI-powered suggestions on what to wear for your next interview.
Find Outfit →Plan your finances with our calculator, updated for 2025 tax regulations.
Calculate Tax →Get accurate, AI-supported salary trends to know your worth and negotiate better.
Check Salaries →Practice for any interview with AI-enabled Q&A sessions. All data is private.
Start Practicing →Use our AI-supported tool to predict potential interview questions based on your resume.
Predict Questions →Use our mock interview trainer to perfect your answers under timed conditions.
Start Timer →Ace tricky behavioral interviews with our AI-powered practice module.
Master Answers →Confidentially record interview questions you were asked for future reference.
Open Journal →A comprehensive tool to help you master every aspect of your interviews.
Become an Ace →Confidentially track your answers to common questions and refine them over time.
View Logs →Schedule and organize your job applications in one confidential planner.
Open Planner →Create perfect, tailored cover letters for each application with AI support.
Generate Letter →Get instant feedback on your resume with our NLP-supported analysis tool.
Check My Score →Check your resume's compatibility with Applicant Tracking Systems (ATS).
Check ATS Score →Use AI to analyze job descriptions and optimize your application materials.
Analyze Application →Confidentially plan and visualize your long-term career path and goals.
Visualize My Career →Get intelligent insights and strategies to confidently negotiate job offers.
Negotiate Offers →Track your entire job search progress from application to offer with this intelligent tool.
Track My Flow →Our intelligent matching engine that provides smart job recommendations.
Get Smart Matches →Tools to build and manage your professional connections. All data is confidential.
Build Network →A classic, O*NET supported template for corporate and professional roles.
Use This Template →A premium, O*NET supported template designed for senior and C-level positions.
Use This Template →A fresh, stylish, O*NET supported template perfect for tech and modern industries.
Use This Template →A visually distinct, O*NET supported template for design and artistic roles.
Use This Template →A clean, simple, O*NET supported template that focuses purely on content.
Use This Template →The standard European Union recommended format for wide compatibility.
Use This Template →An institution-recommended template perfect for internships and first jobs.
Use This Template →An institution-recommended template for recent graduates entering the workforce.
Use This Template →The researcher-recommended format for roles in academia and research.
Use This Template →A tech-savvy recommended template to highlight your technical skills.
Use This Template →A trades-recommended template to showcase hands-on skills and experience.
Use This Template →A sleek, black-and-white, O*NET supported template for a professional look.
Use This Template →An artist-recommended template that allows your creativity to shine.
Use This Template →A researcher-recommended template based on the classic Harvard format.
Use This Template →Help us improve our platform by joining our community research program.
Join Research →Share your experience with our tools to help other job seekers.
Share Experience →Create your free account to save jobs, build your profile, and track applications.
Create Account →Access your dashboard, manage applications, and continue your job search.
Access Your Account →Create a comprehensive professional profile that attracts recruiters and showcases your skills.
Build Your Profile →See your public profile exactly as employers will see it. Make sure it's perfect.
Preview Profile →Keep track of all your saved job opportunities in one organized place.
View Saved Jobs →View and manage all the company reviews you've submitted.
See Your Reviews →Manage the list of companies you follow to stay updated on their new openings.
Manage Following →Discover and research top employers in your country and industry.
Discover Employers →Use our O*NET supported CV builder to create a professional resume from scratch.
Build Your CV →Convert your PDF resumes or documents into editable Word (DOC) format.
Convert PDF →Create universally compatible PDF documents from your Word (DOC) files.
Create PDF →Find answers to common questions about our job site and platform.
Read FAQ →Get help and find answers to questions specifically for job seekers.
Get Help →Learn about the technology and algorithms behind how we match you to jobs.
Learn How →Discover how we use your profile and activity to provide customized job suggestions.
Learn More →Understand our fast application process and how to make the most of it.
Learn More →Learn how to manage your job alert settings so you get the updates you want.
Manage Settings →A complete guide to understanding how job alerts work and how to use them effectively.
Read Guide →Learn how our system matches your resume to job requirements.
Learn More →Read our guide to building a professional and ethical personal brand.
Read Guide →Learn how to increase your visibility to recruiters on our platform.
Increase Visibility →Find out how you can get a verified badge to build trust with employers.
Get Verified →Learn about the advanced AI and ATS technology that powers our platform.
Learn More →Understand how Applicant Tracking Systems rank you as an applicant.
Learn More →Learn how our AI-powered semantic matching goes beyond keywords.
Learn More →Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights
Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph uses a vertical bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each vertical bar represents a different job category, with the size of the vertical bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph uses a funnel chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the funnel represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 964,811+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
There are popular job portals and recruitment agencies active in India. India Jobs Expertini is one of the major portals that can help you find the right job. Expertini.Com can assist you in accessing a wide range of job listings and professional opportunities, in addition to its free CV Builder, Resume Score, and Job Alert tools.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.