Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.
Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.
Senior Software Engineer (Java Full Stack, React.js)
Description We are currently seeking a highly skilled and motivated Senior Software Engineer with expertise in Java Full Stack and React JS to join our dynamic team. As a Senior Engineer, you will play a crucial role in the design, development, and optimization of scalable and h ...
Senior Software Engineer Java Full Stack Angular
Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with m ...
Ai agent and full stack development internship
We’re a US based tech startup. We are looking for AI+Full stack developers.You’ll work on a real production system involving:Multi-agent workflows (Discovery, Deep Dive, Filters, Reports)Stateful AI systems with memory and contextReal-world partner sourcing and analysis pipelinesExample of ou ...
Aws full stack sde (mid/junior level)
AWS Full Stack SDE (Mid/Junior Level)Location: Hyderabad (Work from Office)Employment Type: Full-TimeExperience: 2–6 YearsRole OverviewWe are hiring AWS Full Stack Software Development Engineers (SDEs) to work on enterprise-scale cloud-native applications involving backend APIs, microservices ...
Sde 3 + lead instructor full stack development
About Newton:Newton School of Technology (NST) is a new-age institution redefining technical education in India. Founded by IIT alumni, NST offers a 4-year B. Tech in Computer Science and AI, focused on hands-on learning and deep industry integration. Within two years, over 93% of students have secured paid ...
Custom Software Engineer Java Full Stack Development
As a Custom Software Engineer, a typical day involves leading the design, construction, and configuration of software applications. We are looking for Senior Java Developer. This role requires taking ownership of the development process and serving as the main liaison for project-related communications. The posi ...
Software Engineer (.Net core full stack Angular)
Job Description Job Title: Software Engineer - .Net Full stack developer with Angular Work Location: Bengaluru, Karnataka, India Shifts any: 12.00pm to 9.00pm Work mode: Hybrid - 3 Days office Company Description <p ...
Lead Full Stack Developer (Node JS + Angular )
What’s important to us: We are seeking a Lead Full Stack Developer who will understand the need to achieve a balance between innovation and the most appropriate solution for our clients. One should be passionate about their work, eager to learn and grow, and who is committed to deliveri ...
Java Full stack Developer and Testing Engineer
We are seeking a highly skilled and motivated Java Fullstack Developer with a strong background in automation testing to join our dynamic development team. The ideal candidate will be responsible for designing, developing, and maintaining robust, scalable, and high-performance applications from front to back, ...
Senior Full Stack WordPress Web Developer – India
About the role Navitas is seeking an innovative, and high-performing Senior Full-Stack WordPress Web Developer with significant front-end development experience, expertise in custom WordPress theme and plugin development, and advanced English language skills. The primary purpose of this ...
Senior Java Full Stack Engineer – Capital Markets
Description We’re looking for a Senior Full Stack Engineer to build high performance, cloud native systems. This role blends strong backend engineering with Java/Spring, front end development with React, and modern DevOps practices across Azure. Technical Skills (Must Have) < ...
Full Stack Development(Python Fast API,ReactJS)
Date Posted: Country: IndiaLocation: IN-KA-BENGALURU-NORTHGATE ~ Sy No 2/2 Venkatala Village ~ SY NO 2/2 VENKATALA VILLAGE, Yelahanka HobliPosition Role Type: OnsitePlease NOTE: WE are looking only for Immediate Joiners At RTX, the wo ...
Java Full Stack Developer (Spring boot + react)
Job Details Requirement Type Permanent Job Title Java Full Stack Developer (Spring boot + react) Job Level Middle Management Job Description No. of Openings 6 Job Domain IT Experience - Minimum - Maximum / ( regular), BCA, MSc Specialisation Skills Full Stack Java Developer, Backe ...
Senior software Engineer Java Full stack Developer
Position Description: At CGI, we’re a team of builders. We call our employees members because all who join CGI are building their own company - one that has grown to 72, professionals located in 40 countries. Founded in , CGI is a leading IT and business process services firm committed ...
Senior Software Engineer (Java Full stack developer)
Our Purpose Mastercard powers economies and empowers people in 200+ countries and territories worldwide. Together with our customers, we’re helping build a sustainable economy where everyone can prosper. We support a wide range of digital payments choices, making transactions secure, simple, ...
Technology Lead Full Stack Java Developer – Bangalore
At Broadridge, we've built a culture where the highest goal is to empower others to accomplish more. If you’re passionate about developing your career, while helping others along the way, come join the Broadridge team. We are looking for a Full Stack Java Developer with 7–9 years of experien ...
Dot Net Full Stack (Associate and AVP)
Why Mizuho At Mizuho, we provide the stability of an international industry leader with the career trajectory of a growing business. Our steady, strategic growth gives our people at all levels rewarding degrees of responsibility and richer work experience than a boutique ...
Dot Net Full Stack (Associate and AVP)
Why Mizuho At Mizuho, we provide the stability of an international industry leader with the career trajectory of a growing business. Our steady, strategic growth gives our people at all levels rewarding degrees of responsibility and richer work experience than a boutique firm or an established giant could offer ...
SDE 3 + Lead Instructor Full stack development
About Newton: Newton School of Technology (NST) is a new-age institution redefining technical education in India. Founded by IIT alumni, NST offers a 4-year B. Tech in Computer Science and AI, focused on hands-on learning and deep industry integration. Within two years, over 93% of st ...
AWS Full Stack SDE (Mid/Junior Level)
AWS Full Stack SDE (Mid/Junior Level) Location: Hyderabad (Work from Office) Employment Type: Full-Time Experience: 2–6 Years Role Overview We are hiring AWS Full Stack Software Development Engineers (SDEs) to work on ...
AI Agent and full stack development internship
We’re a US based tech startup. We are looking for AI+Full stack developers. You’ll work on a real production system involving: Multi-agent workflows (Discovery, Deep Dive, Filters, Reports) Stateful AI systems with memory and context Real-world ...
SDE 3 + Lead Instructor Full stack development
About Newton: Newton School of Technology (NST) is a new-age institution redefining technical education in India. Founded by IIT alumni, NST offers a 4-year B. Tech in Computer Science and AI, focused on hands-on learning and deep industry integration. Within two years, over 93% of st ...
Senior Full Stack Developer (Web & CMS Platforms)
Location: Mysore, Karnataka Experience: 7+ Years Employment Type: Full-Time About the Role We are looking for an experienced Senior Full Stack Developer to drive development and ...
AWS Full Stack SDE (Mid/Junior Level)
AWS Full Stack SDE (Mid/Junior Level) Location: Hyderabad (Work from Office) Employment Type: Full-Time Experience: 2–6 Years Role Overview We are hiring AWS Full Stack Software Development Engineers (SDEs) to work on ...
AI Agent and full stack development internship
We’re a US based tech startup. We are looking for AI+Full stack developers. You’ll work on a real production system involving: Multi-agent workflows (Discovery, Deep Dive, Filters, Reports) Stateful AI systems with memory and context Real-wo ...
Senior Full Stack Engineer Python & React JS (India)
About CheckmateCheckmate is a restaurant technology solution provider that has continually evolved over time. We started in 2017 by integrating 3rd party platforms to the POS systems of restaurants. At that time, there were multiple 3rd party platforms like GrubHub, UberEats, DoorDash, ...
Full Stack Developer (React JS Java Spring boot)
<div>Description:</div> <br> <div> <div class="olUlHelper sap-padding-begin-tiny"> <p style="margin: 0in 0in 8pt; line-height: 107%; font-size: 11pt; font-family: Calibri, sans-serif;">Experience</p> <p style="margin: 0in 0i ...
Associate Consultant delivery( Dot NET Full Stack Developer)
Associate Consultant -delivery( Dot NET Full Stack Developer) Date posted 12/21/ Location Pune | India, Chennai | India Company Worldline This is WorldlineWe are the innovators at the heart of the payments technology industry, shaping how the world pays and get ...
Java Full Stack Developer (Advanced) JPMC Chennai, India
Location: ChennaiMinimum 8–12 years of experience in full stack development with strong expertise in Java, API development, and modern front-end technologies. Proven track record in building enterprise-scale web applications, RESTful services, and scalable microservices.Roles and Responsibilities: ...
SRE & DevOps Engineer (Full stack React+NodeJS) (#3951)
Work type: Office/Remote Technical Level: Senior Job Category: Software Development Looking for a company that inspires passion, courage, and innovation? With our client, you can help shape the future of global commerce, influencing how millions of people buy, sell, connect, and share wor ...
Full Stack Developer (React JS Java Spring boot)
Description: Experience 6 8 Years Job Summary We are seeking an experienced Java Microservices Developer with 6 8 years of hands-on experience in designing, developing, and deploying enterprise-grade applications. The ideal candidate should ...
Full Stack Developer (PHP, WordPress, React, Node.js, TypeScript)
Company: Manhattan Tech Ventures Pvt. Ltd.Location: Remote (India)Job Type: Full-timeAbout the RoleManhattan Tech Ventures Pvt. Ltd. is looking for an experienced and highly skilled Senior Full ...
Full Stack Engineer / Associate Director Fullstack Software Engineering
Full Stack Engineer / Associate Director Fullstack Software Engineering Location:Pune, MH, IN, 411006 Brand: HSBC Area of Interest: Technology Closing Date: Hybrid Worker Date: 7 Jun 2026 **Job description** Some careers shine brighter than othe ...
Full Stack Engineer / Associate Director Fullstack Software Engineering
Full Stack Engineer / Associate Director Fullstack Software Engineering Location:Pune, MH, IN, 411006 Brand: HSBC Area of Interest: Technology Closing Date: Hybrid Worker Date: 7 Jun 2026 **Job description** Some careers shine brighter than othe ...
Storage Software Engineer Java Script, Java, Full Stack
**Introduction**India Systems Development Lab (ISDL) is part of IBM Infrastructure world-wide technology development lab. Established in 1996, the Lab is headquartered in India's Silicon Valley and startup hub - Bengaluru, with a strong presence in Pune and Hyderabad. Developers at ISDL deliver technology in ...
Sr Full Stack Engineer AWS, Python, Spark, Pyspark
**Requisition number:** 2337681**Job category:** Technology **#OITech**Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care ...
Senior Application Developer Full Stack (.NET, angular, Azure)
**Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
Lead Application Developer Full stack (.NET, angular, Azure)
**Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
Hire Ahead Intermediate Application Developer .Net Full Stack
**Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
Senior Application Developer Full Stack (.NET, angular, Azure)
**Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
Senior Developer – Dotnet, SQL, Angular Full Stack Developer
**Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
Senior Developer – Dotnet, SQL, Angular Full Stack Developer
**Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...
Senior Information Security Engineer Python Full Stack Developer
**About this role:** Wells Fargo is seeking a Senior Information Security Engineer. **In this role, you will:** + Lead or participate in computer security incident response activities for moderately complex events+ Conduct technical investigation of security related incidents and p ...
Lead Application Developer Full stack (.NET, angular, Azure)
**Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
Hire Ahead Intermediate Application Developer .Net Full Stack
**Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...
Java Full Stack Developer SAP Business Accelerator Hub
**We help the world run better**At SAP, we keep it simple: you bring your best to us, and we'll bring out the best in you. We're builders touching over 20 industries and 80% of global commerce, and we need your unique talents to help shape what's next. The work is challenging – but it matters. You'll find a ...
Software Engineer /Full Stack Java Developer/GenAI/UI
Job Description **About this role:** Wells Fargo is seeking a Software Engineer **In this role, you will:** + Participate in low to moderately complex initiatives and projects associated with the technology domain, including installation, upgrades, and deployment efforts+ ...
Lead Information Security Engineer Python Full Stack Developer
**About this role:** Wells Fargo is seeking a Lead Information Security Engineer. **In this role, you will:** + Lead computer security incident response activities for highly complex events+ Conduct technical investigation of security related incidents and post incident digital for ...
Software Engineering Lead Full Stack Java and Angular
**Requisition number:** 2349022**Job category:** Technology Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benef ...
Specialist Software Engineer – Full Stack AI/ML/GenAI
**ABOUT AMGEN** Amgen harnesses the best of biology and technology to fight the world’s toughest diseases, and make people’s lives easier, fuller and longer. We discover, develop, manufacture and deliver innovative medicines to help millions of patients. Amgen helped establish the biotechnology industry ...
Stand out from thousands of applicants. Use our proven career tools to optimize your applications and land your dream job faster.
Organize your job search and personal tasks. All data is confidential.
Open Planner →Access your confidential wellness report and resources to manage job search stress.
Check Wellbeing →Plan your skill development with O*NET support to stay competitive in your field.
Start Coaching →Get AI-powered suggestions on what to wear for your next interview.
Find Outfit →Plan your finances with our calculator, updated for 2025 tax regulations.
Calculate Tax →Get accurate, AI-supported salary trends to know your worth and negotiate better.
Check Salaries →Practice for any interview with AI-enabled Q&A sessions. All data is private.
Start Practicing →Use our AI-supported tool to predict potential interview questions based on your resume.
Predict Questions →Use our mock interview trainer to perfect your answers under timed conditions.
Start Timer →Ace tricky behavioral interviews with our AI-powered practice module.
Master Answers →Confidentially record interview questions you were asked for future reference.
Open Journal →A comprehensive tool to help you master every aspect of your interviews.
Become an Ace →Confidentially track your answers to common questions and refine them over time.
View Logs →Schedule and organize your job applications in one confidential planner.
Open Planner →Create perfect, tailored cover letters for each application with AI support.
Generate Letter →Get instant feedback on your resume with our NLP-supported analysis tool.
Check My Score →Check your resume's compatibility with Applicant Tracking Systems (ATS).
Check ATS Score →Use AI to analyze job descriptions and optimize your application materials.
Analyze Application →Confidentially plan and visualize your long-term career path and goals.
Visualize My Career →Get intelligent insights and strategies to confidently negotiate job offers.
Negotiate Offers →Track your entire job search progress from application to offer with this intelligent tool.
Track My Flow →Our intelligent matching engine that provides smart job recommendations.
Get Smart Matches →Tools to build and manage your professional connections. All data is confidential.
Build Network →A classic, O*NET supported template for corporate and professional roles.
Use This Template →A premium, O*NET supported template designed for senior and C-level positions.
Use This Template →A fresh, stylish, O*NET supported template perfect for tech and modern industries.
Use This Template →A visually distinct, O*NET supported template for design and artistic roles.
Use This Template →A clean, simple, O*NET supported template that focuses purely on content.
Use This Template →The standard European Union recommended format for wide compatibility.
Use This Template →An institution-recommended template perfect for internships and first jobs.
Use This Template →An institution-recommended template for recent graduates entering the workforce.
Use This Template →The researcher-recommended format for roles in academia and research.
Use This Template →A tech-savvy recommended template to highlight your technical skills.
Use This Template →A trades-recommended template to showcase hands-on skills and experience.
Use This Template →A sleek, black-and-white, O*NET supported template for a professional look.
Use This Template →An artist-recommended template that allows your creativity to shine.
Use This Template →A researcher-recommended template based on the classic Harvard format.
Use This Template →Help us improve our platform by joining our community research program.
Join Research →Share your experience with our tools to help other job seekers.
Share Experience →Create your free account to save jobs, build your profile, and track applications.
Create Account →Access your dashboard, manage applications, and continue your job search.
Access Your Account →Create a comprehensive professional profile that attracts recruiters and showcases your skills.
Build Your Profile →See your public profile exactly as employers will see it. Make sure it's perfect.
Preview Profile →Keep track of all your saved job opportunities in one organized place.
View Saved Jobs →View and manage all the company reviews you've submitted.
See Your Reviews →Manage the list of companies you follow to stay updated on their new openings.
Manage Following →Discover and research top employers in your country and industry.
Discover Employers →Use our O*NET supported CV builder to create a professional resume from scratch.
Build Your CV →Convert your PDF resumes or documents into editable Word (DOC) format.
Convert PDF →Create universally compatible PDF documents from your Word (DOC) files.
Create PDF →Find answers to common questions about our job site and platform.
Read FAQ →Get help and find answers to questions specifically for job seekers.
Get Help →Learn about the technology and algorithms behind how we match you to jobs.
Learn How →Discover how we use your profile and activity to provide customized job suggestions.
Learn More →Understand our fast application process and how to make the most of it.
Learn More →Learn how to manage your job alert settings so you get the updates you want.
Manage Settings →A complete guide to understanding how job alerts work and how to use them effectively.
Read Guide →Learn how our system matches your resume to job requirements.
Learn More →Read our guide to building a professional and ethical personal brand.
Read Guide →Learn how to increase your visibility to recruiters on our platform.
Increase Visibility →Find out how you can get a verified badge to build trust with employers.
Get Verified →Learn about the advanced AI and ATS technology that powers our platform.
Learn More →Understand how Applicant Tracking Systems rank you as an applicant.
Learn More →Learn how our AI-powered semantic matching goes beyond keywords.
Learn More →Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights
Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph uses a vertical bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each vertical bar represents a different job category, with the size of the vertical bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph uses a funnel chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the funnel represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 964,311+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
There are popular job portals and recruitment agencies active in India. India Jobs Expertini is one of the major portals that can help you find the right job. Expertini.Com can assist you in accessing a wide range of job listings and professional opportunities, in addition to its free CV Builder, Resume Score, and Job Alert tools.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.