964,311+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

Professional job seekers finding India jobs through Expertini
750,000+ professionals on Expertini 750,000+ Candidates
Join our global community
Expertini Penguin Mascot Resume Score™
Resume Score™ Instantly
Upload Your CV
Quick 30-second process

Apply Today & Jumpstart Your Career on Expertini, Trusted Since 2008.

Reset

Create Job Alert

 
   
Reset

Senior Software Engineer (Java Full Stack, React.js)

Description We are currently seeking a highly skilled and motivated Senior Software Engineer with expertise in Java Full Stack and React JS to join our dynamic team. As a Senior Engineer, you will play a crucial role in the design, development, and optimization of scalable and h ...

Senior Software Engineer Java Full Stack Angular

Description EPAM is a leading global provider of digital platform engineering and development services. We are committed to having a positive impact on our customers, our employees, and our communities. We embrace a dynamic and inclusive culture. Here you will collaborate with m ...

Ai agent and full stack development internship

We’re a US based tech startup. We are looking for AI+Full stack developers.You’ll work on a real production system involving:Multi-agent workflows (Discovery, Deep Dive, Filters, Reports)Stateful AI systems with memory and contextReal-world partner sourcing and analysis pipelinesExample of ou ...

Aws full stack sde (mid/junior level)

AWS Full Stack SDE (Mid/Junior Level)Location: Hyderabad (Work from Office)Employment Type: Full-TimeExperience: 2–6 YearsRole OverviewWe are hiring AWS Full Stack Software Development Engineers (SDEs) to work on enterprise-scale cloud-native applications involving backend APIs, microservices ...

Sde 3 + lead instructor full stack development

About Newton:Newton School of Technology (NST) is a new-age institution redefining technical education in India. Founded by IIT alumni, NST offers a 4-year B. Tech in Computer Science and AI, focused on hands-on learning and deep industry integration. Within two years, over 93% of students have secured paid ...

Custom Software Engineer Java Full Stack Development

As a Custom Software Engineer, a typical day involves leading the design, construction, and configuration of software applications. We are looking for Senior Java Developer. This role requires taking ownership of the development process and serving as the main liaison for project-related communications. The posi ...

Software Engineer (.Net core full stack Angular)

Job Description Job Title: Software Engineer - .Net Full stack developer with Angular Work Location: Bengaluru, Karnataka, India Shifts any: 12.00pm to 9.00pm Work mode: Hybrid - 3 Days office Company Description <p ...

Lead Full Stack Developer (Node JS + Angular )

What’s important to us: We are seeking a Lead Full Stack Developer who will understand the need to achieve a balance between innovation and the most appropriate solution for our clients. One should be passionate about their work, eager to learn and grow, and who is committed to deliveri ...

Java Full stack Developer and Testing Engineer

We are seeking a highly skilled and motivated Java Fullstack Developer with a strong background in automation testing to join our dynamic development team. The ideal candidate will be responsible for designing, developing, and maintaining robust, scalable, and high-performance applications from front to back, ...

Senior Full Stack WordPress Web Developer – India

About the role Navitas is seeking an innovative, and high-performing Senior Full-Stack WordPress Web Developer with significant front-end development experience, expertise in custom WordPress theme and plugin development, and advanced English language skills. The primary purpose of this ...

Senior Java Full Stack Engineer – Capital Markets

Description We’re looking for a Senior Full Stack Engineer to build high performance, cloud native systems. This role blends strong backend engineering with Java/Spring, front end development with React, and modern DevOps practices across Azure. Technical Skills (Must Have) < ...

Full Stack Development(Python Fast API,ReactJS)

Date Posted: Country: IndiaLocation: IN-KA-BENGALURU-NORTHGATE ~ Sy No 2/2 Venkatala Village ~ SY NO 2/2 VENKATALA VILLAGE, Yelahanka HobliPosition Role Type: OnsitePlease NOTE: WE are looking only for Immediate Joiners At RTX, the wo ...

Java Full Stack Developer (Spring boot + react)

Job Details Requirement Type Permanent Job Title Java Full Stack Developer (Spring boot + react) Job Level Middle Management Job Description No. of Openings 6 Job Domain IT Experience - Minimum - Maximum / ( regular), BCA, MSc Specialisation Skills Full Stack Java Developer, Backe ...

Senior software Engineer Java Full stack Developer

Position Description: At CGI, we’re a team of builders. We call our employees members because all who join CGI are building their own company - one that has grown to 72, professionals located in 40 countries. Founded in , CGI is a leading IT and business process services firm committed ...

Senior Software Engineer (Java Full stack developer)

Our Purpose Mastercard powers economies and empowers people in 200+ countries and territories worldwide. Together with our customers, we’re helping build a sustainable economy where everyone can prosper. We support a wide range of digital payments choices, making transactions secure, simple, ...

Technology Lead Full Stack Java Developer – Bangalore

At Broadridge, we've built a culture where the highest goal is to empower others to accomplish more. If you’re passionate about developing your career, while helping others along the way, come join the Broadridge team. We are looking for a Full Stack Java Developer with 7–9 years of experien ...

Dot Net Full Stack (Associate and AVP)

Why Mizuho At Mizuho, we provide the stability of an international industry leader with the career trajectory of a growing business. Our steady, strategic growth gives our people at all levels rewarding degrees of responsibility and richer work experience than a boutique ...

Dot Net Full Stack (Associate and AVP)

Why Mizuho At Mizuho, we provide the stability of an international industry leader with the career trajectory of a growing business. Our steady, strategic growth gives our people at all levels rewarding degrees of responsibility and richer work experience than a boutique firm or an established giant could offer ...

SDE 3 + Lead Instructor Full stack development

About Newton: Newton School of Technology (NST) is a new-age institution redefining technical education in India. Founded by IIT alumni, NST offers a 4-year B. Tech in Computer Science and AI, focused on hands-on learning and deep industry integration. Within two years, over 93% of st ...

AWS Full Stack SDE (Mid/Junior Level)

AWS Full Stack SDE (Mid/Junior Level) Location: Hyderabad (Work from Office) Employment Type: Full-Time Experience: 2–6 Years Role Overview We are hiring AWS Full Stack Software Development Engineers (SDEs) to work on ...

AI Agent and full stack development internship

We’re a US based tech startup. We are looking for AI+Full stack developers. You’ll work on a real production system involving: Multi-agent workflows (Discovery, Deep Dive, Filters, Reports) Stateful AI systems with memory and context Real-world ...

SDE 3 + Lead Instructor Full stack development

About Newton: Newton School of Technology (NST) is a new-age institution redefining technical education in India. Founded by IIT alumni, NST offers a 4-year B. Tech in Computer Science and AI, focused on hands-on learning and deep industry integration. Within two years, over 93% of st ...

AWS Full Stack SDE (Mid/Junior Level)

AWS Full Stack SDE (Mid/Junior Level) Location: Hyderabad (Work from Office) Employment Type: Full-Time Experience: 2–6 Years Role Overview We are hiring AWS Full Stack Software Development Engineers (SDEs) to work on ...

AI Agent and full stack development internship

We’re a US based tech startup. We are looking for AI+Full stack developers. You’ll work on a real production system involving: Multi-agent workflows (Discovery, Deep Dive, Filters, Reports) Stateful AI systems with memory and context Real-wo ...

Senior Full Stack Engineer Python & React JS (India)

About CheckmateCheckmate is a restaurant technology solution provider that has continually evolved over time. We started in 2017 by integrating 3rd party platforms to the POS systems of restaurants. At that time, there were multiple 3rd party platforms like GrubHub, UberEats, DoorDash, ...

Full Stack Developer (React JS Java Spring boot)

<div>Description:</div> <br> <div> <div class="olUlHelper sap-padding-begin-tiny"> <p style="margin: 0in 0in 8pt; line-height: 107%; font-size: 11pt; font-family: Calibri, sans-serif;">Experience</p> <p style="margin: 0in 0i ...

Associate Consultant delivery( Dot NET Full Stack Developer)

Associate Consultant -delivery( Dot NET Full Stack Developer) Date posted 12/21/ Location Pune | India, Chennai | India Company Worldline This is WorldlineWe are the innovators at the heart of the payments technology industry, shaping how the world pays and get ...

Java Full Stack Developer (Advanced) JPMC Chennai, India

Location: ChennaiMinimum 8–12 years of experience in full stack development with strong expertise in Java, API development, and modern front-end technologies. Proven track record in building enterprise-scale web applications, RESTful services, and scalable microservices.Roles and Responsibilities: ...

SRE & DevOps Engineer (Full stack React+NodeJS) (#3951)

Work type: Office/Remote Technical Level: Senior Job Category: Software Development Looking for a company that inspires passion, courage, and innovation? With our client, you can help shape the future of global commerce, influencing how millions of people buy, sell, connect, and share wor ...

Full Stack Developer (React JS Java Spring boot)

Description: Experience 6 8 Years Job Summary We are seeking an experienced Java Microservices Developer with 6 8 years of hands-on experience in designing, developing, and deploying enterprise-grade applications. The ideal candidate should ...

Full Stack Developer (PHP, WordPress, React, Node.js, TypeScript)

Company: Manhattan Tech Ventures Pvt. Ltd.Location: Remote (India)Job Type: Full-timeAbout the RoleManhattan Tech Ventures Pvt. Ltd. is looking for an experienced and highly skilled Senior Full ...

Full Stack Engineer / Associate Director Fullstack Software Engineering

Full Stack Engineer / Associate Director Fullstack Software Engineering Location:Pune, MH, IN, 411006 Brand: HSBC Area of Interest: Technology Closing Date: Hybrid Worker Date: 7 Jun 2026 **Job description** Some careers shine brighter than othe ...

Full Stack Engineer / Associate Director Fullstack Software Engineering

Full Stack Engineer / Associate Director Fullstack Software Engineering Location:Pune, MH, IN, 411006 Brand: HSBC Area of Interest: Technology Closing Date: Hybrid Worker Date: 7 Jun 2026 **Job description** Some careers shine brighter than othe ...

Storage Software Engineer Java Script, Java, Full Stack

**Introduction**India Systems Development Lab (ISDL) is part of IBM Infrastructure world-wide technology development lab. Established in 1996, the Lab is headquartered in India's Silicon Valley and startup hub - Bengaluru, with a strong presence in Pune and Hyderabad. Developers at ISDL deliver technology in ...

Sr Full Stack Engineer AWS, Python, Spark, Pyspark

**Requisition number:** 2337681**Job category:** Technology **#OITech**Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care ...

Senior Application Developer Full Stack (.NET, angular, Azure)

**Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...

Lead Application Developer Full stack (.NET, angular, Azure)

**Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...

Hire Ahead Intermediate Application Developer .Net Full Stack

**Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...

Senior Application Developer Full Stack (.NET, angular, Azure)

**Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...

Senior Developer – Dotnet, SQL, Angular Full Stack Developer

**Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...

Senior Developer – Dotnet, SQL, Angular Full Stack Developer

**Before you apply to a job, select your language preference from the options available at the top right of this page.** Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you bec ...

Senior Information Security Engineer Python Full Stack Developer

**About this role:** Wells Fargo is seeking a Senior Information Security Engineer. **In this role, you will:** + Lead or participate in computer security incident response activities for moderately complex events+ Conduct technical investigation of security related incidents and p ...

Lead Application Developer Full stack (.NET, angular, Azure)

**Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...

Hire Ahead Intermediate Application Developer .Net Full Stack

**Avant de postuler à un emploi, sélectionnez votre langue de préférence parmi les options disponibles en haut à droite de cette page.** Découvrez votre prochaine opportunité au sein d'une organisation qui compte parmi les 500 plus importantes entreprises mondiales. Envisagez des opportunités innovantes ...

Java Full Stack Developer SAP Business Accelerator Hub

**We help the world run better**At SAP, we keep it simple: you bring your best to us, and we'll bring out the best in you. We're builders touching over 20 industries and 80% of global commerce, and we need your unique talents to help shape what's next. The work is challenging – but it matters. You'll find a ...

Software Engineer /Full Stack Java Developer/GenAI/UI

Job Description **About this role:** Wells Fargo is seeking a Software Engineer **In this role, you will:** + Participate in low to moderately complex initiatives and projects associated with the technology domain, including installation, upgrades, and deployment efforts+ ...

Lead Information Security Engineer Python Full Stack Developer

**About this role:** Wells Fargo is seeking a Lead Information Security Engineer. **In this role, you will:** + Lead computer security incident response activities for highly complex events+ Conduct technical investigation of security related incidents and post incident digital for ...

Software Engineering Lead Full Stack Java and Angular

**Requisition number:** 2349022**Job category:** Technology Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benef ...

Specialist Software Engineer – Full Stack AI/ML/GenAI

**ABOUT AMGEN** Amgen harnesses the best of biology and technology to fight the world’s toughest diseases, and make people’s lives easier, fuller and longer. We discover, develop, manufacture and deliver innovative medicines to help millions of patients. Amgen helped establish the biotechnology industry ...

🚀 Boost Your Hiring Chances with Our AI-Powered Tool-Kit

Stand out from thousands of applicants. Use our proven career tools to optimize your applications and land your dream job faster.

To-Do Planner

Organize your job search and personal tasks. All data is confidential.

Open Planner

Wellbeing Center

Access your confidential wellness report and resources to manage job search stress.

Check Wellbeing

Skill Coach

Plan your skill development with O*NET support to stay competitive in your field.

Start Coaching

Outfit Helper

Get AI-powered suggestions on what to wear for your next interview.

Find Outfit

Income Tax Calculator

Plan your finances with our calculator, updated for 2025 tax regulations.

Calculate Tax

Salary Benchmark

Get accurate, AI-supported salary trends to know your worth and negotiate better.

Check Salaries

Interview Practice

Practice for any interview with AI-enabled Q&A sessions. All data is private.

Start Practicing

Interview Predictor

Use our AI-supported tool to predict potential interview questions based on your resume.

Predict Questions

Interview Practice Timer

Use our mock interview trainer to perfect your answers under timed conditions.

Start Timer

Behavioral Mastery

Ace tricky behavioral interviews with our AI-powered practice module.

Master Answers

Question Journal

Confidentially record interview questions you were asked for future reference.

Open Journal

Interview Ace

A comprehensive tool to help you master every aspect of your interviews.

Become an Ace

Q&A Logs

Confidentially track your answers to common questions and refine them over time.

View Logs

Application Planner

Schedule and organize your job applications in one confidential planner.

Open Planner

Cover Letter Tool

Create perfect, tailored cover letters for each application with AI support.

Generate Letter

Resume Score

Get instant feedback on your resume with our NLP-supported analysis tool.

Check My Score

ATS Score

Check your resume's compatibility with Applicant Tracking Systems (ATS).

Check ATS Score

Application Analyzer

Use AI to analyze job descriptions and optimize your application materials.

Analyze Application

Career Visualizer

Confidentially plan and visualize your long-term career path and goals.

Visualize My Career

Offer Genius

Get intelligent insights and strategies to confidently negotiate job offers.

Negotiate Offers

JobFlow

Track your entire job search progress from application to offer with this intelligent tool.

Track My Flow

JobSense

Our intelligent matching engine that provides smart job recommendations.

Get Smart Matches

Networking Toolkit

Tools to build and manage your professional connections. All data is confidential.

Build Network

Professional CV

A classic, O*NET supported template for corporate and professional roles.

Use This Template

Executive CV

A premium, O*NET supported template designed for senior and C-level positions.

Use This Template

Modern CV

A fresh, stylish, O*NET supported template perfect for tech and modern industries.

Use This Template

Creative CV

A visually distinct, O*NET supported template for design and artistic roles.

Use This Template

Minimalist CV

A clean, simple, O*NET supported template that focuses purely on content.

Use This Template

Europass CV

The standard European Union recommended format for wide compatibility.

Use This Template

Student CV

An institution-recommended template perfect for internships and first jobs.

Use This Template

Graduate CV

An institution-recommended template for recent graduates entering the workforce.

Use This Template

Academic CV

The researcher-recommended format for roles in academia and research.

Use This Template

Developer/IT CV

A tech-savvy recommended template to highlight your technical skills.

Use This Template

Skilled Worker CV

A trades-recommended template to showcase hands-on skills and experience.

Use This Template

Monochrome CV

A sleek, black-and-white, O*NET supported template for a professional look.

Use This Template

Art CV

An artist-recommended template that allows your creativity to shine.

Use This Template

Harvard CV

A researcher-recommended template based on the classic Harvard format.

Use This Template

Volunteer Research

Help us improve our platform by joining our community research program.

Join Research

Review Us

Share your experience with our tools to help other job seekers.

Share Experience

Register

Create your free account to save jobs, build your profile, and track applications.

Create Account

Login

Access your dashboard, manage applications, and continue your job search.

Access Your Account

Profile Builder

Create a comprehensive professional profile that attracts recruiters and showcases your skills.

Build Your Profile

View Profile

See your public profile exactly as employers will see it. Make sure it's perfect.

Preview Profile

Bookmarked Jobs

Keep track of all your saved job opportunities in one organized place.

View Saved Jobs

Your Reviews

View and manage all the company reviews you've submitted.

See Your Reviews

Following

Manage the list of companies you follow to stay updated on their new openings.

Manage Following

Find Companies

Discover and research top employers in your country and industry.

Discover Employers

Standalone CV Builder

Use our O*NET supported CV builder to create a professional resume from scratch.

Build Your CV

PDF to DOC (Beta)

Convert your PDF resumes or documents into editable Word (DOC) format.

Convert PDF

DOC to PDF (Beta)

Create universally compatible PDF documents from your Word (DOC) files.

Create PDF

General FAQ

Find answers to common questions about our job site and platform.

Read FAQ

Job Seekers FAQ

Get help and find answers to questions specifically for job seekers.

Get Help

Job Matching

Learn about the technology and algorithms behind how we match you to jobs.

Learn How

Personalized Matching

Discover how we use your profile and activity to provide customized job suggestions.

Learn More

Quick Apply

Understand our fast application process and how to make the most of it.

Learn More

Alert Frequency

Learn how to manage your job alert settings so you get the updates you want.

Manage Settings

Job Alerts Guide

A complete guide to understanding how job alerts work and how to use them effectively.

Read Guide

Resume Matching

Learn how our system matches your resume to job requirements.

Learn More

Ethical Branding

Read our guide to building a professional and ethical personal brand.

Read Guide

Candidate Visibility

Learn how to increase your visibility to recruiters on our platform.

Increase Visibility

Verified Badge

Find out how you can get a verified badge to build trust with employers.

Get Verified

AI ATS Technology

Learn about the advanced AI and ATS technology that powers our platform.

Learn More

ATS Ranking

Understand how Applicant Tracking Systems rank you as an applicant.

Learn More

Semantic Matching

Learn how our AI-powered semantic matching goes beyond keywords.

Learn More

    Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights