📑 About Us:We are a dynamic and rapidly expanding residential solar installation business based in California, USA. Our mission is to make clean energy accessible to homeowners and accelerate the adoption of solar power throughout the United States. After bootstrapping our early growth, ...
📑 Apply Before:20/05/2025Position: MERN Stack DeveloperLocation: Stop, Dange Chowk, Thergaon, Pune,Employment Type: Full TimeCTC: As per company norms.Position Overview:As a MERN Stack Developer, you will be re ...
📑 Roles and Responsibility Proficiency in MongoDB configuration/design Design & Develop the product features and modules Devise solutions focusing on non-functional product requirements like Performance, Security, Reliability, Stability Best practices of Agile develop ...
📑 Parallel Wireless is a pioneer in Open RAN innovation, transforming how mobile networks are built, optimized, and powered. Through our GreenRAN™ portfolio, we enable operators to deliver next-generation connectivity with unmatched energy efficiency, automation, and flexibility.What you need ...
📑 Description :We are seeking a highly skilled MERN Stack Developer with 3+ years of experience to join our dynamic team.(Less than 3 Years of experience Please DO NOT APPLY).The ideal candidate should have strong expertise in TypeScript, JavaScript, Node.js, Express.js, Ne ...
📑 Develop and maintain web applications using MongoDB, , , and (MERN stack).Design, implement, and optimize APIs, front-end components, and database structures for scalability and performance.Collaborate with teams to troubleshoot issues, deploy applications, and ensure a seamless user experience. Experien ...
📑 Job Description – MERN Stack DeveloperCompany Name: Aurus IT Solutions (AHA Smart Homes)Job Role: MERN Stack DeveloperLocation: MumbaiSalary: As per company standardsEmploymen ...
📑 Job Description Description : We are hiring a Lead Developer (MERN Stack Developer), who also has technical skills in JavaScript, Dot Net Technologies with 2 years of experience. Salary: 25000- 30000. Location : Technopark ...
📑 Job Title: Senior Developer Full Stack (MERN)Location: Pal, Surat (Onsite position)Company: Doyenhub Software Solutions Pvt LtdBudget: 4 to 6 LPAEducation: MCA, BE/-IT/Computer, MSC-ITExperience: Minimum 3+ years of experienceJD for Sr. Full Stack DeveloperAs a Senior Fullstack Developer, you will be responsible ...
📑 About UsAt Codvo, we are committed to building scalable, future-ready data platforms that power business impact. We believe in a culture of innovation, collaboration ...
📑 Job Overview:We are seeking a skilled MERN Stack Developer to join our dynamic team. The ideal candidate will be responsible for designing, developing, and maintaining web applications using the MERN (MongoDB, Express.js, React.js, Node.js) technology stack.Key Responsibi ...
📑 **Requisition number:** 2331068**Job category:** Technology Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benef ...
📑 JOB DETAILS Collaborating with managers to determine blockchain technology needs and envisaged functionalities.Creating application features and interfaces by using programming languages and writing multithreaded codes. Applying the latest cryptology techniques to protect ...
📑 Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you become better every day. We know what it takes to lead UPS into tomorrow—people with a unique combination of skill + passion. ...
📑 JOB DETAILS 1) Collaborating with managers to determine blockchain technology needs and envisaged functionalities2) Creating application features and interfaces by using programming languages and writing multithreaded codes 3) Applying the latest cryptology techniques to p ...
📑 Our Purpose Mastercard powers economies and empowers people in 200+ countries and territories worldwide. Together with our customers, we’re helping build a sustainable economy where everyone can prosper. We support a wide range of digital payments choices, making transactions secure, simple, ...
📑 Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you become better every day. We know what it takes to lead UPS into tomorrow—people with a unique combination of skill + passion. ...
📑 Full Stack Engineer | C# / TypeScript / Node.js | AgTech Platform | 100% remote | $90,00 - $120,000 + Equity The Company They are a rapidly growing technology startup operating at the intersection of software, data, and artificial intelligence in the ...
📑 JOB DETAILS 1) Collaborating with managers to determine blockchain technology needs and envisaged functionalities2) Creating application features and interfaces by using programming languages and writing multithreaded codes3) Applying the latest cryptology techniques to p ...
📑 JOB DETAILS Collaborating with managers to determine blockchain technology needs and envisaged functionalities.Creating application features and interfaces by using programming languages and writing multithreaded codes.Applying the latest cryptology techniques to protect ...
📑 Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work wi ...
📑 Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work wi ...
📑 At Nielsen, we believe that career growth is a partnership. You ultimately own, fuel and set the journey. By joining our team of nearly 14,000 associates, you will become part of a community that will help you to succeed. We champion you because when you succeed, we do too. Embark on a new initiative, explore a ...
📑 At Nielsen, we believe that career growth is a partnership. You ultimately own, fuel and set the journey. By joining our team of nearly 14,000 associates, you will become part of a community that will help you to succeed. We champion you because when you succeed, we do too. Embark on a new initiative, explore a ...
📑 JOB DETAILS Web Developer Job Duties:Regular exposure to business stakeholders and executive management, as well as the authority and scope to apply your expertise to many interesting technical problems. Candidate must have a strong understanding of UI, cross-browser compa ...
📑 At Nielsen, we believe that career growth is a partnership. You ultimately own, fuel and set the journey. By joining our team of nearly 14,000 associates, you will become part of a community that will help you to succeed. We champion you because when you succeed, we do too. Embark on a new initiative, explore a ...
📑 Description About this Role : We are seeking a Senior Full Stack Engineer who is an absolute expert in AI-assisted development. You are a power user of tools like Claude, Cursor, or Copilot, and you understand that Prompt Engineering is actually Context Engineering. ...
📑 Lead Software Engineer – Assurant, GCC India We are seeking a Full Stack Tech Lead who will provide technical and delivery leadership for enterprise-grade applications across frontend, backend, and cloud platforms. This role involves owning architecture and design decisions, guiding implem ...
📑 At Nielsen, we believe that career growth is a partnership. You ultimately own, fuel and set the journey. By joining our team of nearly 14,000 associates, you will become part of a community that will help you to succeed. We champion you because when you succeed, we do too. Embark on a new initiative, explore a ...
📑 JOB DETAILS Web Developer Job Duties:Regular exposure to business stakeholders and executive management, as well as the authority and scope to apply your expertise to many interesting technical problems.Candidate must have a strong understanding of UI, cross-browser compa ...
📑 Description About this Role: We are seeking a Senior Full Stack Engineer who is an absolute expert in AI-assisted development. You are a power user of tools like Claude, Cursor, or Copilot, and you understand that Prompt Engineering is actually Context Engineering. Y ...
📑 At Nielsen, we believe that career growth is a partnership. You ultimately own, fuel and set the journey. By joining our team of nearly 14,000 associates, you will become part of a community that will help you to succeed. We champion you because when you succeed, we do too. Embark on a new initiative, explore a ...
📑 Lead Software Engineer – Assurant, GCC IndiaWe are seeking a Full Stack Tech Lead who will provide technical and delivery leadership for enterprise-grade applications across frontend, backend, and cloud platforms. This role involves owning architecture and design decisions, guiding implemen ...
📑 At Nielsen, we believe that career growth is a partnership. You ultimately own, fuel and set the journey. By joining our team of nearly 14,000 associates, you will become part of a community that will help you to succeed. We champion you because when you succeed, we do too. Embark on a new initiative, explore a ...
📑 About Us EDMO is an AI-powered company that provides enrollment-centric solutions to universities, colleges, and higher education institutions. By streamlining repetitive tasks - such as document verification, transcript evaluation, SOP/essay reviews, ...
📑 Job Title Engineer L3- Full Stack developer Location (s) Cochin Years of Experience 5-8yrs Job Description At least 5+ year of experience in building large-scale software applications · Proficiency in front-end web development technologies such as HTML, CSS, JavaScript, and ...
📑 Job Overview Build and maintain scalable web UI components and Node.js services for marketplace and portal features across Uvation platforms. The role involves developing responsive frontend experiences, creating backend APIs, integrating third-party services, and ensuri ...
📑 About Position:We are seeking a highly skilled Network Stack Developer (C/C++) to join our team working on next-generation firewall platforms, including SonicOS Gen 7 and Gen 8. These platforms introduce advanced capabilities such as a modernized UI, TLS 1.3 decryption, mu ...
📑 Job Overview: As an Azure Stack HCI Engineer, you will be responsible for managing and supporting the organization's hybrid cloud infrastructure based on Microsoft Azure Stack HCI. This role requires deep technical knowledge of Azure Stack HCI, hyper-converged infr ...
📑 Quest Global is an organization at the forefront of innovation and one of the world’s fastest growing engineering services firms with deep domain knowledge and recognized expertise in the top OEMs across seven industries. We are a twenty-five-year-old company on a journey to becoming a centenary one, driven b ...
📑 At Nielsen, we believe that career growth is a partnership. You ultimately own, fuel and set the journey. By joining our team of nearly 14,000 associates, you will become part of a community that will help you to succeed. We champion you because when you succeed, we do too. Embark on a new initiative, explore a ...
📑 Description We are seeking a highly skilled and experienced Lead Mean Stack Developer to join our innovative team. The ideal candidate will be proficient in Angular 8+ and NGRX for frontend development. The candidate should have a strong background in utilizing Agile m ...
📑 Job Overview Build and maintain scalable web UI components and Node.js services for marketplace and portal features across Uvation platforms. The role involves developing responsive frontend experiences, creating backend APIs, integrating third-party services, and ensurin ...
📑 • 3+ years’ experience as an OpenStack Engineer • 3+ years’ experience with Linux Administration • Must have an account of storage platforms; Ceph Storage experience specifically preferred • Solid networking knowledge ...
📑 Description - ExternalOptum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benefits, data and resources they need to feel their be ...
📑 Job Title Engineer L3- Full Stack developer Location (s) Cochin Years of Experience 5-8yrs Job Description At least 5+ year of experience in building large-scale software applications · Proficiency in front-end web development technologies such as HTML, CSS, JavaScript, ...
📑 Roles and Responsibility Proficiency in MongoDB configuration/design Design & Develop the product features and modules Devise solutions focusing on non-functional product requirements like Performance, Security, Reliability, Stability Best practices of Agile dev ...
📑 Description We are actively seeking a Senior Mean Stack Developer with a strong background in JavaScript, specifically ES6+ and TypeScript, to join our innovative team. The ideal candidate will be proficient in Angular 8+ and NGRX for frontend development as well as ha ...
📑 Quest Global is an organization at the forefront of innovation and one of the world’s fastest growing engineering services firms with deep domain knowledge and recognized expertise in the top OEMs across seven industries. We are a twenty-five-year-old company on a journey to becoming a centenary one, driven b ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,657,784+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| MERN Stack Developer | Lytegen | Full time |
| Mern stack Developer. | Radical Technologies | Full-time |
| Mern Stack - Jr.Developer | Multi Recruit | Full-time |
| Tech Lead, Stack | Parallel Wireless | Full Time |
| MERN Stack Developer | Infowind Technologies | Mobile App Development Company in India | fullTime |
| Mern Stack Developer | Orpol Infotech | FULL_TIME |
| MERN Stack Developer | Jobaddaa | Full-time |
| MERN Stack Developer | CONNECTING 2 WORK | Full Time |
| Mern Stack Developer | Toolify Private Limited | FULL_TIME |
| MEAN Stack Developer | Codvo.ai | FULL TIME |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!