📑 Field sales by visiting retailers as well as wholesalers at hardwares & sanitaryware shops Experience 0 - 4 Years No. of Openings 1 Education Higher Secondary, Vocational Course, B.B.A, B.Com Role Sales Executive ...
📑 Safety: Ensure that construction projects comply with safety regulations and guidelinesProject progress: Monitor the progress of construction projectsWork planning: Help project managers plan the workMaterial management: Manage the orders and deliveries of construction materialsSchedule management: Organize staf ...
📑 Field sales by visiting retailers as well as wholesalers at hardwares & sanitaryware shops Experience 0 - 4 Years No. of Openings 1 Education Higher Secondary, Vocational Course, B.B.A, B.Com Role Sales Executive ...
📑 JOB DESCRIPTION Req ID: 370090 We are currently seeking a Helpdesk Analyst - Full Time to join our team in Noida, Uttar Pradesh (IN-UP), India (IN).In these roles, you will be responsible for:Provide exceptional IT Service Desk support, guidance, and training to end-users for vario ...
📑 Hindi,Gujrati lenguage aani chahiyeNo qualification required. Experience Fresher No. of Openings 1 Education Secondary School Role Telecaller Industry Type Call Centre / BPO / KPO / ITES / ...
📑 Hiring for 500 systeam operator Jobs in Hyderabad, Karimnagar, Khammam, Kurnool, Nellore, Nizamabad, Ongole, Prakasam, Sambalpur, Tirupati, for Freshers,Required Educational Qualification is : I.T.I., B.A, B.Arch, B.C.A, B.B.A, B.Com, Bachelor of Hotel Management, B.Pharma, B.Sc, LLB with Good knowledge in CCTV ...
📑 marketing executive for building industryExperience1 - 2 YearsNo. of Openings2EducationHigher Secondary, Secondary School, Diploma, Professional Degree, B.C.A, B.ComRoleMarketing ExecutiveIndustry TypeArchit ...
📑 Excel Automation. MIS , Reporting. should be good with advanced Excel functions and VBA macros. Knowledge of SQL will be added advantage.Experience0 - 6 YearsNo. of Openings5RoleVBA DeveloperIndustry TypeIT-Hardware & Networking / ...
📑 CNC PROGRAMMER AND SETTERExperience3 - 5 YearsNo. of Openings1EducationGraduateRoleCNC ProgrammerIndustry TypeManufacturing / Production / QualityGenderMaleJob Country< ...
📑 Hindi,Gujrati lenguage aani chahiyeNo qualification required. Experience Fresher No. of Openings 1 Education Secondary School Role Telecaller Industry Type Call Centre / BPO / KPO / ITES / ...
📑 Hiring for 500 systeam operator Jobs in Hyderabad, Karimnagar, Khammam, Kurnool, Nellore, Nizamabad, Ongole, Prakasam, Sambalpur, Tirupati, for Freshers,Required Educational Qualification is : I.T.I., B.A, B.Arch, B.C.A, B.B.A, B.Com, Bachelor of Hotel Management, B.Pharma, B.Sc, LLB with Good knowledge in CCTV ...
📑 _*Hiring for a Respected University (Lucknow Location)*_Position : *Admission Counsellor* (Marketing)Salary : * to Per Month Fix* (Upto 4 LPA)Department : *Admission Department*Qualification : *Any Graduate*Experience: *1 to 3 Years of BFSI or preferably from the Education Background*Job Description Responsible ...
📑 Hiring for 1 Cashier Job in Nashik, for Freshers,Required Educational Qualification is : Higher Secondary, Secondary School, , , Other Bachelor Degree with Good knowledge in Cash Handling, Cash Collection, Cashier Activities, Petty Cash Management etc. Experience 0 - 2 Years No ...
📑 Hindi,Gujrati lenguage aani chahiyeNo qualification required. Experience Fresher No. of Openings 1 Education Secondary School Role Telecaller Industry Type Call Centre / BPO / KPO / ITES / ...
📑 Position: Senior Instructor &nb ...
📑 Job Title: Accounting ExecutiveLocation: Mohali, PunjabDepartment: Accounts & FinanceTiming - 10am - 7pm.Reporting To: Finance Manager / Operations HeadEmployment Type: Full-timeAbout the CompanyWe are an upcoming company in the sexual health domain, building health-tech solutions for various sexual healthand we ...
📑 gas fire and multi fuel boiler experience requiredExperience2 YearsNo. of Openings7Education12th Pass, 10th Pass, B.E, B.Tech, Post Graduate DiplomaRoleBoiler AttendantIndustry TypeManufacturing / Production ...
📑 Job Openings Consultant CardiologistLocations :Punjab Jalandhar , AmritsarHaryana - Bahadurgarh , Rohtak , Sirsa Uttar Pradesh AgraGujarat - RajkotIf you are interested, please share your updated CV along with your current and expected salary.Referrals are also welcome.RegardsAnju BhattiExperience1 ...
📑 We are building a high-performing engineering team that harnesses the power of Claude AI and Agentic Code, and we need a technical leader who thrives equally in architecture reviews and in the weeds of a pull request. This is a rare opportunity to define how an ambitious, AI-native engineering culture is buil ...
📑 Description & Summary: A career within Data and Analytics services will provide you with the opportunity to help organisations uncover enterprise insights and drive business results using smarter data analytics. We focus on a collection of organisational technology capabilities, including ...
📑 A MERN Stack Developer is responsible for designing, developing, and maintaining full-stack web applications using MongoDB, , , and . The role involves building responsive user interfaces, developing backend APIs, managing databases, and ensuring smooth integration between frontend and backend systems. The devel ...
📑 Job Title : Senior Software Engineer Experience Level: 4-8 Years Location : Chennai (Onsite) About Rezolve.ai We're an AI-first SaaS company leveraging the l ...
📑 Job Description Job Description We are looking for a React Native developer/ Frontend Stack Developer. You will be responsible for architecting and building these applications, as well as coordinating with the teams responsible for other layers of the product ...
📑 MEAN/MERN STACK DEVELOPER CUM TRAINER Job Type : Full Time Category IT: Software Locations Kochi Summary Job Summary Strong problem solving skills Ability to handle web apps using HTML5, CSS3,Bootstrap,Javascript,jQue ...
📑 Description & Summary: A career within Data and Analytics services will provide you with the opportunity to help organisations uncover enterprise insights and drive business results using smarter data analytics. We focus on a collection of organisational technology capabilities, including ...
📑 Company- Crisp Analytics (LUMIQ ) - Experience: 5–7 YearsEmployment Type: Full-time Location- Sector-62, Noida Key Responsibilities </stron ...
📑 • Strong Solution Architect with Experience in IBM ODM, BPM, and Azure platforms and migrating those workloads to Azure cloud (VMs/Cloudpaks/AKS) • Ability to understand modernization requirements, current state and come up with target state architecture • Knowledge of AKS, Azure App services, Event hu ...
📑 Description & Summary:We are looking for a Data Engineer with strong expertise in SQL Server, Data Warehousing, SSIS, and Data Modeling , combined with hands-on experience in AI/LLMs , especially for enabling agentic AI capabilities within reports, portals, and ...
📑 Company Description Colan Infotech is a CMMI level 3 certified company headquartered in Chennai with over 500 employees. The company specializes in digitizing firms and providing technology solutions across mobile, web, AI, and blockchain domains. Colan Infotech is recognized as one of the 50 fastest g ...
📑 Job Summary :We are looking for a passionate and experienced MERN Stack Developer to join our growingteam. The ideal candidate will be proficient in MongoDB, , React, and .Experience with is a strong advantage. You will be responsible for creating andmaintaining robust, high-performa ...
📑 Project Description:The opportunity is with one of the leading Australian banks. The team operates across multiple geographic locations. Technologies utilized include Oracle WebLogic, OWC, JOLT, and SALT.Responsibilities:- Provide Level ...
📑 Key Responsibilities1. Test Strategy & ExecutionDefine and execute testing protocols with scientific rigor: establish electrochemistry-grounded hypotheses, design tests to validate or refute them, and quantify all findings (degradation rates, f ...
📑 Description & Summary: A career within Data and Analytics services will provide you with the opportunity to help organisations uncover enterprise insights and drive business results using smarter data analytics. We focus on a collection of organisational technology capabilities, including bu ...
📑 • Strong Solution Architect with Experience in IBM ODM, BPM, and Azure platforms and migrating those workloads to Azure cloud (VMs/Cloudpaks/AKS) • Ability to understand modernization requirements, current state and come up with target state architecture • Knowledge of AKS, Azure App services, Event hu ...
📑 A MERN Stack Developer is responsible for designing, developing, and maintaining full-stack web applications using MongoDB, , , and . The role involves building responsive user interfaces, developing backend APIs, managing databases, and ensuring smooth integration between frontend and backend systems. The devel ...
📑 Description & Summary:We are looking for a Data Engineer with strong expertise in SQL Server, Data Warehousing, SSIS, and Data Modeling, combined with hands-on experience in AI/LLMs, especially for enabling agentic AI capabilities within reports, portals, and data ...
📑 Job Summary :We are looking for a passionate and experienced MERN Stack Developer to join our growingteam. The ideal candidate will be proficient in MongoDB, , React, and .Experience with is a strong advantage. You will be responsible for creating andmaintaining robust, high-performance ...
📑 Company DescriptionColan Infotech is a CMMI level 3 certified company headquartered in Chennai with over 500 employees. The company specializes in digitizing firms and providing technology solutions across mobile, web, AI, and blockchain domains. Colan Infotech is recognized as one of the 50 fastest gr ...
📑 Description & Summary: A career within Data and Analytics services will provide you with the opportunity to help organisations uncover enterprise insights and drive business results using smarter data analytics. We focus on a collection of organisational technology capabilities, including bu ...
📑 Company- Crisp Analytics (LUMIQ) - Experience: 5–7 YearsEmployment Type: Full-time</st ...
📑 Job Description Job DescriptionWe are looking for a React Native developer/ Frontend Stack Developer. You will be responsible for architecting and building these applications, as well as coordinating with the teams responsible for other layers of the product inf ...
📑 MEAN/MERN STACK DEVELOPER CUM TRAINER Job Type : Full Time Category IT: Software Locations Kochi Summary Job Summary Strong problem solving skills Ability to handle web apps using HTML5, CSS3,Bootstrap,Javascript,jQuery,Angul ...
📑 Job Title : Senior Software Engineer Experience Level: 4-8 Years Location : Chennai (Onsite) About Rezolve.ai We're an AI-first SaaS company leveraging t ...
📑 DescriptionThe Amazon Web Services TA team is looking for a talented, customer-focused Recruiter who will work with a team of Sourcers and Recruiting Coordinators focusing on the areas of candidate talent search, process improvement and will act as Recruiter for supported business. They will foster ...
📑 DescriptionThe Amazon Web Services TA team is looking for a talented, customer-focused Recruiter who will work with a team of Sourcers and Recruiting Coordinators focusing on the areas of candidate talent search, process improvement and will act as Recruiter for supported business. They will foster ...
📑 DescriptionThe Amazon Web Services TA team is looking for a talented, customer-focused Recruiter who will work with a team of Sourcers and Recruiting Coordinators focusing on the areas of candidate talent search, process improvement and will act as Recruiter for supported business. They will foster ...
📑 DescriptionThe Amazon Web Services TA team is looking for a talented, customer-focused Recruiter who will work with a team of Sourcers and Recruiting Coordinators focusing on the areas of candidate talent search, process improvement and will act as Recruiter for supported business. They will foster ...
📑 Full Chip PD Lead (8 Years Experience) Locations: Bangalore, Hyderabad, Noida, Ahmedabad, Chennai, Pune Job Description: We are seeking a highly experienced Full Chip PD Lead to drive top-level physical design activities for complex, high-performance SoCs. The ideal candidate will have hands-on expertise in data ...
📑 Creative Designer We are looking for a talented creative designer to join our growing premium personal care brand. This is a ground floor opportunity to shape the creative identity of a brand from the beginning and have real ownership over the work you produce. What you'll be doing: Conceptualising and designing ...
📑 Full Chip PD Lead (8+ Years Experience)Locations: Bangalore, Hyderabad, Noida, Ahmedabad, Chennai, PuneJob Description:We are seeking a highly experienced Full Chip PD Lead to drive top-level physical design ac ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,657,796+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Sales Executive (Full Time) | Mohammedi Polytech | FULL_TIME |
| Site Supervisior (full Time) | Placement India | FULL_TIME |
| Sales Executive (Full Time) | Mohammedi Polytech | FULL_TIME |
| Helpdesk Analyst - Full Time | NTT | Full-time |
| Telecaller - Full Time - Freshers | Advance Mobile Repairing Institute | FULL_TIME |
| System Operator (full Time) | Right Fit Resources | Full-time |
| Marketing Executive (Full Time) | Mega Fountains | FULL_TIME |
| VBA Developer (Full Time) | Osmose Technology | FULL_TIME |
| CNC Programmer - Full Time | Alfa Enterprise | FULL_TIME |
| Telecaller - Full Time - Freshers | Advance Mobile Repairing Institute | FULL_TIME |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!