📑 battery , inverter , solar panels installation contact on: Experience 1 - 3 Years No. of Openings 2 Education Higher Secondary, Diploma, Professional Degree Role Service Technician Industry Type</ ...
📑 Job Summary:We are seeking a responsible and vigilant Night Administrator to oversee hospital operations during night shifts. The role ensures smooth functioning of clinical and non-clinical services, patient coordination, staff supervision, and adherence to hospital policies during night ho ...
📑 Urgent opening For Design Engineer- Nashik - DIPLOMA / BEMale / Female Freshers /Experienced.Sal - 15 K to 35 K Experience 0 - 3 Years No. of Openings 3 Education Diploma, B.E Role Design Engineer ...
📑 Job Summary: We are looking for a highly skilled Full-Chip Static Timing Analysis (STA) Engineer with 3–6 years of experience in VLSI Physical Design/Timing Closure. The candidate will be responsible for full-chip timing analysis, timing closure, constraint developme ...
📑 Job Openings for 500 Relationship Manager Jobs with minimum 2 Years Experience in Mathura, Agra, Kanpur, Kanpur Dehat, Prayagraj, Varanasi, Lucknow, Etah, Etawah, Gorakhpur, having Educational qualification of : Higher Secondary, Professional Degree with Good knowledge in MANAGEMENT, Sales Team Leader, Sales Man ...
📑 Job Openings for 3 Hair Dresser Jobs with minimum 1 Year Experience in Nashik having Educational qualification of : 10th Pass with Good knowledge in Hair Colour, Hair Cutting, Hair Care, Beautician Activities, Shaving, Salon, Parlour etc.Experience1 - 3 YearsNo. of Openings3< ...
📑 Job Purpose:To make powerful and successful sales presentations in different settings; to keep abreast with the organization's products and services; to crack profitable deals and referrals to achieve sales targetsJob Responsibilities:1. Achieving stretched targets in a result-focused environment2. Preparing pre ...
📑 Responsibilities:Understanding Project Requirements: Collaborate with stakeholders to understand project objectives, functional requirements, and design specifications.Conceptual Design and Development: Generate innovative design concepts and solutions that meet project requirements, considering factors such as ...
📑 Post - 1Jewelry Sales - FemaleB2B and B2CSmart and good-lookingJob Location- = SaroliJob Time - to Experience - 2 to 3 years in same fieldGraduate in any field Computer knowledge Fluent in English Customer service and follow-up Salary - as per experience Experience 2 - 3 Years ...
📑 Good in accounts teaching and well presentableExperience0 - 2 YearsNo. of Openings1EducationB.ComRoleAccounts TeacherIndustry TypeEducation / Teaching / Training / Colleges /Institutes / Universities</li ...
📑 We are looking for 1 Operation Executive Post in Nashik, with deep knowledge in Documentation, Strategic Communication, Growth Strategy and Required Educational Qualification is : Professional Degree, , , Other Bachelor Degree, Post Graduate Diploma Experience 1 - 2 Years No. o ...
📑 • Extensive knowledge in multiple testbench structures • Knowledge of FPGA and emulation platforms • Proficiency in UVM • PCIe/CXL support and compliance • Knowledge of assertion-based formal verification • A good understanding of the complete verification life cycle (test plan, testbenc ...
📑 • 2+ years’ experience in one of the following Cloud technologies: AWS, Azure, Google, OpenStack • 1+ years’ experience with one of the following Agile methodologies: Scrum, SAFe, and Kanban • 2+ Years’ experience in one of the following Quality Assurance technologies: ATDD, Selenium, Cucumber, JUnit, ...
📑 Hiring: Accountant Kalamboli Full-TimeCreateTogether Foundation is looking for a detail-oriented Accountant to join our team in Kalamboli.We work across Maharashtra on education support, school infrastructure development, and social impact initiatives. Were seeking someone who can maintain strong financial disci ...
📑 Job Openings for 10 manual accountant Jobs with minimum 2 Years Experience in Surat, having Educational qualification of : Higher Secondary, Secondary School, , , with Good knowledge in Manual Accounting etc. Experience 2 - 3 Years No. of Openings 10 ...
📑 We're Hiring! Kannada Teacher Full Time Location: Kumarapark, Bangalore Timings: Monday to Saturday | 11:00 AM 8:00 PM Join us: IMMEDIATELY! Mode: 100% OFFLINE | ONSITE because real learning happ ...
📑 Field sales by visiting retailers as well as wholesalers at hardwares & sanitaryware shops Experience 0 - 4 Years No. of Openings 1 Education Higher Secondary, Vocational Course, B.B.A, B.Com Role Sales Executive ...
📑 Cardiac Anesthetist :UP - Agra, LucknowGujarat - Ahmedabad, Bhavnagar For More details or to apply:- Contact:Hargun Kaur, HR Associate (.E)+Experience0 - 6 YearsNo. of Openings3EducationMBBS, MD/Medicine Doctor, Ph.D/DoctorateRole ...
📑 We are looking for an Alliance Executive to join our team in Kochi. The ideal candidate will be responsible for building and maintaining strategic partnerships with various stakeholders. This is a full-time position, and candidates are required to work from the office.**Key Responsibilities:**- **Develop Strateg ...
📑 Job Title: Ground Staff - AviationJob Overview:Ground Staff in aviation ensure efficient and safe operations at the airport. This role involves assisting passengers, handling luggage, managing aircraft services, and maintaining airport safety. Ground staff contribute directly to creating a smooth travel experien ...
📑 Tele-caling, voice processExperience0 - 3 YearsNo. of Openings25EducationHigher SecondaryRoleTelecallerIndustry TypeCall Centre / BPO / KPO / ITES / LPOGender[ Male / Female ] ...
📑 Government proposed jobVery high chance to get permanent govt job in LIC as this is financial Advisor professional scheme launch by our honorable PM mr Modi ji so hurry up call me Experience0 - 5 YearsNo. of Openings120EducationHigher Secondary ...
📑 Job title: Field officerTotal experience:0-5 yearsQualification: GraduationRequired: smartphone mobile, bike, driving licenceLocation: All over IndiaWork,: field visit, survey work, Salary:Experience0 - 5 YearsNo. of Openings20EducationB.A, B.Arch, B.C. ...
📑 Diploma Civil Engineer- Nashik freshersSite EngineerDIP Civil -MaleExp -Min 6 MSal-Upto 16 K + allowance.Travel JobNashik. Experience 0 - 3 Years No. of Openings 5 Education Diploma, B.E Role Civil Engineer ...
📑 Courier delivery Experience 0 - 1 Years No. of Openings 5 Education Secondary School Role Courier Boy Industry Type Transportation / Logistic / Shipping / Marine / Courier / Freight / Cargo ...
📑 - Oversee the daily operations of the dispatch department: This includes managing schedules, coordinating with drivers, and ensuring timely delivery of goods to customers.- Monitor inventory levels and coordinate with suppliers: Keeping track of inventory levels to prevent stockouts and working closely with supp ...
📑 Work closely & jointly with Defense service employees and business partners to ensure organisation achieves its business aspiration in line with the AOP Targets (New & Customer Retention) as stated in individual objective setting sheets. Support channel partner in delivering higher levels of productivity and fac ...
📑 Pizza Delivery boy jobExperience0 - 1 YearsNo. of Openings10EducationHigher SecondaryRoleDelivery BoyIndustry TypeFMCG / Food / BeveragesGenderMaleJob CountryInd ...
📑 Safety: Ensure that construction projects comply with safety regulations and guidelinesProject progress: Monitor the progress of construction projectsWork planning: Help project managers plan the workMaterial management: Manage the orders and deliveries of construction materialsSchedule management: Organize staf ...
📑 Field sales by visiting retailers as well as wholesalers at hardwares & sanitaryware shops Experience 0 - 4 Years No. of Openings 1 Education Higher Secondary, Vocational Course, B.B.A, B.Com Role Sales Executive ...
📑 gas fire and multi fuel boiler experience requiredExperience2 YearsNo. of Openings7Education12th Pass, 10th Pass, B.E, B.Tech, Post Graduate DiplomaRoleBoiler AttendantIndustry TypeManufacturing / Production ...
📑 Job Title: Accounting ExecutiveLocation: Mohali, PunjabDepartment: Accounts & FinanceTiming - 10am - 7pm.Reporting To: Finance Manager / Operations HeadEmployment Type: Full-timeAbout the CompanyWe are an upcoming company in the sexual health domain, building health-tech solutions for various sexual healthand we ...
📑 _*Hiring for a Respected University (Lucknow Location)*_Position : *Admission Counsellor* (Marketing)Salary : * to Per Month Fix* (Upto 4 LPA)Department : *Admission Department*Qualification : *Any Graduate*Experience: *1 to 3 Years of BFSI or preferably from the Education Background*Job Description Responsible ...
📑 Hiring for 1 Cashier Job in Nashik, for Freshers,Required Educational Qualification is : Higher Secondary, Secondary School, , , Other Bachelor Degree with Good knowledge in Cash Handling, Cash Collection, Cashier Activities, Petty Cash Management etc. Experience 0 - 2 Years No ...
📑 Hindi,Gujrati lenguage aani chahiyeNo qualification required. Experience Fresher No. of Openings 1 Education Secondary School Role Telecaller Industry Type Call Centre / BPO / KPO / ITES / ...
📑 Job Openings Consultant CardiologistLocations :Punjab Jalandhar , AmritsarHaryana - Bahadurgarh , Rohtak , Sirsa Uttar Pradesh AgraGujarat - RajkotIf you are interested, please share your updated CV along with your current and expected salary.Referrals are also welcome.RegardsAnju BhattiExperience1 ...
📑 Hiring for 500 systeam operator Jobs in Hyderabad, Karimnagar, Khammam, Kurnool, Nellore, Nizamabad, Ongole, Prakasam, Sambalpur, Tirupati, for Freshers,Required Educational Qualification is : I.T.I., B.A, B.Arch, B.C.A, B.B.A, B.Com, Bachelor of Hotel Management, B.Pharma, B.Sc, LLB with Good knowledge in CCTV ...
📑 Excel Automation. MIS , Reporting. should be good with advanced Excel functions and VBA macros. Knowledge of SQL will be added advantage.Experience0 - 6 YearsNo. of Openings5RoleVBA DeveloperIndustry TypeIT-Hardware & Networking / ...
📑 CNC PROGRAMMER AND SETTERExperience3 - 5 YearsNo. of Openings1EducationGraduateRoleCNC ProgrammerIndustry TypeManufacturing / Production / QualityGenderMaleJob Country< ...
📑 Dispatch Head Gender : Male Qualification : Diploma in Mechanical Engineering / BE in Mechanical Engineering Designation : Dispatch Head Experience : 4 5 Years Salary Range : 15K to 25K Technical Skills: Proficiency in logistics and dispatch management Strong knowledge of supply chain and logistics operations Ex ...
📑 JOB DESCRIPTION Req ID: 370090 We are currently seeking a Helpdesk Analyst - Full Time to join our team in Noida, Uttar Pradesh (IN-UP), India (IN).In these roles, you will be responsible for:Provide exceptional IT Service Desk support, guidance, and training to end-users for vario ...
📑 Hindi,Gujrati lenguage aani chahiyeNo qualification required. Experience Fresher No. of Openings 1 Education Secondary School Role Telecaller Industry Type Call Centre / BPO / KPO / ITES / ...
📑 Team player,effective communication skills, basic understanding of organization culture and behavior Experience 0 - 6 Years No. of Openings 20 Education MBBS Role Medical Officer Industry Type ...
📑 creating functional, safe, and aesthetically pleasing spaces by designing plans, selecting materials, and overseeing project execution.Experience4 - 9 YearsNo. of Openings5EducationM.ArchRoleInterior DesignerIndust ...
📑 We have vacant of 25 Associate Accountant Jobs in Nashik, Experience Required : 2 Years Educational Qualification : , /PGDM, Skill Tally etc. Experience 2 - 3 Years No. of Openings 25 Education B.Com, M.B.A/PGDM, M.Com Role< ...
📑 battery , inverter , solar panels installation contact on: Experience 1 - 3 Years No. of Openings 2 Education Higher Secondary, Diploma, Professional Degree Role Service Technician Industry Type</ ...
📑 We are Hiring for Design Engineerbe Mechanical Malecatia - Ugnx- Autocad- Solid Workfresher 15 Kexperience upto 30 K. Experience 0 - 5 Years No. of Openings 2 Education Diploma, B.E, M.Tech Role Design Engineer < ...
📑 Job Summary :We are seeking a meticulous and detail-oriented Tender Executive to manage the end-to-end tender process for our [Specify Products/Services] in Nashik and across India. The Tender Executive will be responsible for identifying relevant tenders, preparing comprehensive and co ...
📑 Assisting Architects in architectural design drafting, preparation of municipal submission and completion drawing, preparing conceptual presentation drawing, detailed working drawing, preparing consultants drawing incorporation etc.Experience2 - 8 YearsNo. of Openings2</l ...
📑 Field sales by visiting retailers as well as wholesalers at hardwares & sanitaryware shops Experience 0 - 4 Years No. of Openings 1 Education Higher Secondary, Vocational Course, B.B.A, B.Com Role Sales Executive ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,657,791+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Service Technician (Full Time) | Horizon Batteries | FULL_TIME |
| Night Admin - Full Time | Platinum Hospitals Pvt Ltd | FULL_TIME |
| Design Engineer (Full Time) | Placement India | FULL_TIME |
| Full-Chip STA Engineer | Proxelera | Full-time |
| Relationship Manager (Full Time) | Cultieff | FULL_TIME |
| Hair Dresser (Full Time) | Placement India | FULL_TIME |
| Relation Manager - Full Time | Confidential | FULL_TIME |
| Design Engineer (Full Time) | Placement India | FULL_TIME |
| Sales (Full Time) (Female) | Agarwal Job Placement | FULL_TIME |
| Accounts Teacher (Full Time) | Mindset Shift | PART_TIME |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!