1,631,592+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

Exec2 Legacy Stack Dig AirBPJio

📑 Job Description:-Design, develop, and maintain high-performance backend applications using Java Spring Boot.Build and integrate RESTful APIs and microservices to ensure scalable and modular system architecture.Design and optimize database queries, stored procedures, functions, ...

Lead Engineer Bluetooth Stack Development

📑 About the Team:The Bluetooth R&D team at Silicon Labs develops and maintains Bluetooth protocol stack software supporting Bluetooth Classic and Bluetooth Low Energy (BLE). The team delivers scalable, standards-compliant Bluetooth solutions used across a wide range of applications, including data ...

ShimentoX Technologies MERN Stack Developer

📑 We are looking for a MERN Stack Developer to join our dynamic team from Hyderabad. This role offers the opportunity to work on cutting-edge web applications, collaborate with talented professionals, and contribute to building scalable, high-performance solutions.<br ...

IN_Manager_Full Stack Lead_Data and Analytics_Advisory_Bangalore

📑 Description & Summary: A career within Data and Analytics services will provide you with the opportunity to help organisations uncover enterprise insights and drive business results using smarter data analytics. We focus on a collection of organisational technology capabilities, including ...

Senior Executive_ Engineer_Full Stack Developer_Pune

📑 Job DescriptionRoles and Responsibilities:1. Perform design, development, and implementation of Java based Applications using Java8, Spring boot, Maven, WebLogic, and React with the integration with AWS services.2. Collaborate with Product Owners (POs), Scrum Masters, and Agile ...

Application Developer – Microsoft .NET Stack

📑 Application Developer Microsoft .NET Stack Location: Bangalore Experience: Relevant experience required (Senior Consultant level) Interview Mode: Face-to-Face (mandatory) Job Overview: We are seeking an experienced Application Developer with strong expertise in the Microsoft .NET Stack. The role involves design ...

Application Developer – Microsoft .NET Stack

📑 ? Hiring: Application Developer Microsoft .NET Stack ? Location: Bangalore ? Employment Type: Full-Time ?? Experience: 8+ Years ? Budget: 9.23 LPA We are looking for an experienced Application Developer with strong expertise in the Microsoft .NET Stack to design, develop, and maintain scalable enterprise applic ...

Full Chip STA Engineer

📑 Job Summary: We are looking for a highly skilled Full-Chip Static Timing Analysis (STA) Engineer with 3–6 years of experience in VLSI Physical Design/Timing Closure. The candidate will be responsible for full-chip timing analysis, timing closure, constraint development, and optimization ...

System Operator (full Time)

📑 Hiring for 500 systeam operator Jobs in Hyderabad, Karimnagar, Khammam, Kurnool, Nellore, Nizamabad, Ongole, Prakasam, Sambalpur, Tirupati, for Freshers,Required Educational Qualification is : I.T.I., B.A, B.Arch, B.C.A, B.B.A, B.Com, Bachelor of Hotel Management, B.Pharma, B.Sc, LLB with Good knowledge in CCTV ...

Full Time Sales Consultant

📑 Company Description Silicon Practice India is a digital healthcare technology provider focusing on transforming clinical operations throughout India. Leveraging over 18 years of innovation originally developed in the UK, Silicon Practice delivers secure, scalable, and user-friendly digital solutions to general p ...

Full Chip Verification Specialist

📑 Hi,Opening for Full chip SOC DV requirement with PCIe (Gen 5) and DDR4/DDR5 subsystem experience (10+ yrs)Job Description for 1 PCIe Req5 to 8 years of experience in design verification in a fast-paced development environmen ...

System Operator (full Time)

📑 Hiring for 500 systeam operator Jobs in Hyderabad, Karimnagar, Khammam, Kurnool, Nellore, Nizamabad, Ongole, Prakasam, Sambalpur, Tirupati, for Freshers,Required Educational Qualification is : I.T.I., B.A, B.Arch, B.C.A, B.B.A, B.Com, Bachelor of Hotel Management, B.Pharma, B.Sc, LLB with Good knowledge in CCTV ...

Systems Specialist/Full Stack_2204

📑 Systems Specialist/Full Stack_2204Overall Objectives of JobA demanding role within AD&M Group that involves development and maintenance of projects in Advanced Java related technologies. This role offers opportunities to undertake project work und ...

STA engineer (full chip)

📑 Quest Global is an organization at the forefront of innovation and one of the world’s fastest growing engineering services firms with deep domain knowledge and recognized expertise in the top OEMs across seven industries. We are a twenty-five-year-old company on a journey to becoming a centenary one, driven b ...

Appointment Setter (Full Time)

📑 Our client seeks a motivated and skilled Appointment Setter to join their sales team. The primary responsibility of this role is to contact potential clients, introduce our products/services, and schedule appointments for our sales representatives.The ideal candidate will possess excel ...

Telecaller Full Time Freshers

📑 I Need Tele Caller CounsellorExperience0 - 5 YearsNo. of Openings100Education12th PassRoleTele CallerIndustry TypeCall Centre / BPO / KPO / ITES / LPOGender[ Male / Female ]<l ...

Full Chip STA Engineer

📑 Job Summary: We are looking for a highly skilled Full-Chip Static Timing Analysis (STA) Engineer with 3–6 years of experience in VLSI Physical Design/Timing Closure. The candidate will be responsible for full-chip timing analysis, timing closure, constraint developme ...

Full Time Physics Teacher

📑 Job Description: Physics Faculty (JEE/NEET & Foundation) Location: Rajkot Position: Full-Time Faculty Subject: Physics Salary: 55K Experience: Minimum 3 years for regular candidates Minimum 1 year for IIT/NIT graduates About the Role We are seeking a highly skilled and passionate Physics Faculty to teach student ...

Academies Director Full Time

📑 Director – Industry Relations, GCGC, GITAM (Deemed to be University), is a key leadership role within the GITAM Career Guidance Centre (GCGC) GCGC (GITAM Career Guidance Center) is a strategic initiative aimed at guiding, training and assisting students with the best career opportunities. To execute this mission ...

Account Director Full Time

📑 AdyatanTech is an IT services and products company focusing on Dynamics 365 consulting and implementation services, along with other technologies. Our customers based out of India, USA, Canada, United Kingdom. Position Details Designation: Executive – Accounts Experience: 2 - 3 Years Qualification: B.Com / M.Com ...

System Operator (full Time)

📑 Hiring for 500 systeam operator Jobs in Hyderabad, Karimnagar, Khammam, Kurnool, Nellore, Nizamabad, Ongole, Prakasam, Sambalpur, Tirupati, for Freshers,Required Educational Qualification is : I.T.I., B.A, B.Arch, B.C.A, B.B.A, B.Com, Bachelor of Hotel Management, B.Pharma, B.Sc, LLB with Good knowledge in CCTV ...

Firmware Engineer (Full Time)

📑 Seeking a skilled Firmware Engineer in Nerul, Navi Mumbai, with 3-5 years of experience and a Diploma in relevant field. Responsibilities include developing embedded systems, implementing communication protocols like UART, SPI, and I2C, and ensuring smooth operation of firmware. Key skills required include exper ...

Mechanical Engineer  (full Time)

📑 Job Openings for 1 Mechanical engineer Job with minimum 1 Year Experience in Nashik, having Educational qualification of : Diploma, Professional Degree with Good knowledge in Mechanical engineer etc. Experience 1 - 2 Years No. of Openings 1 Educ ...

Courier Delivery (full Time)

📑 Courier delivery Experience 0 - 1 Years No. of Openings 5 Education Secondary School Role Courier Boy Industry Type Transportation / Logistic / Shipping / Marine / Courier / Fr ...

Marketing Executive (Full Time)

📑 We have vacant of 189 Marketing Executive Jobs in Gaya, Darbhanga, Kanpur, Lucknow, Gorakhpur, Delhi, Noida, Surat, Hyderabad, Ranchi, for Freshers Educational Qualification : Higher Secondary, Secondary School, Vocational Course, , , , , , Skill Marketing Communication, Marketing, Online Marketing, Basic Comput ...

Kitchen Helper (Full Time)

📑 Who's Candidates, Intrested in kitchen work, And Want Carrier in hotel Industry, only those candidates applyExperience 0 - 1 Years No. of Openings 15 Education Secondary School Role Kitchen Helper Industry Type ...

Sales Executive (Full Time)

📑 Field sales by visiting retailers as well as wholesalers at hardwares & sanitaryware shops Experience 0 - 4 Years No. of Openings 1 Education Higher Secondary, Vocational Course, B.B.A, B.Com Role Sales Exe ...

ITI Fitter (Full Time)

📑 Responsibilities:Assembly and Fitting: Assemble mechanical components and equipment accurately as per blueprints, drawings, and specifications.Installation: Install machinery and equipment at the required locations, ensuring proper alignment and functionality.Maintenance and Repair: Perform routine maintenance, ...

Telecaller Full Time Freshers

📑 - GOOD KNOWLEDGE OF COMPUTER, EXCEL, WORD, ETC.- GOOD COMMUNICATION SKILLS, SPEAK GOOD ENGLISH- CUSTOMER CONVINCING SKILLS, PROBLEM SOLVING SKILLS. Experience 0 - 1 Years No. of Openings 1 Education Higher Secondary, Secondary School, D ...

Boiler Attendant (Full Time)

📑 gas fire and multi fuel boiler experience requiredExperience 2 Years No. of Openings 7 Education 12th Pass, 10th Pass, B.E, B.Tech, Post Graduate Diploma Role Boiler Attendant Industry Type Manufacturing ...

Junior Accountant Full Time

📑 manages an organization's financial health by recording transactions, preparing financial statements (P&L, Balance Sheet, Cash Flow), managing budgets, ensuring tax compliance, and analyzing data to advise leadership on financial strategy, cost reduction, and profit enhancement, working with various departments ...

Cashier Full Time Freshers

📑 Hiring for 1 Cashier Job in Nashik, for Freshers,Required Educational Qualification is : Higher Secondary, Secondary School, , , Other Bachelor Degree with Good knowledge in Cash Handling, Cash Collection, Cashier Activities, Petty Cash Management etc. Experience 0 - 2 Years ...

Python Developer Full Time

📑 Skills & Requirements:Sound knowledge in Python (FastAPI)AWSPostgreSQL / SupabaseQueuing systems (Kafka, Airflow)Knowledge in GEN-AI, ML, DL, TensorFlow, PyTorchKey Responsibilities: Write clean, scalable, and efficient codeDevelop back-end components to improve responsiveness and performanceIntegrate user-facin ...

CFD Engineer (full Time)

📑 Job Summary : We are seeking a motivated and skilled CFD Engineer with 2 - 4 years of industry experience to join our engineering team. The ideal candidate should have a strong understanding of fluid dynamics and thermal analysis, practical experience with commercial CFD software and the c ...

Design Engineer (Full Time)

📑 Urgent opening For Design Engineer- Nashik - DIPLOMA / BEMale / Female Freshers /Experienced.Sal - 15 K to 35 K Experience 0 - 3 Years No. of Openings 3 Education Diploma, B.E Role Design Engineer </l ...

Tender Executive (Full Time)

📑 Job Summary :We are seeking a meticulous and detail-oriented Tender Executive to manage the end-to-end tender process for our (Specify Products/Services) in Nashik and across India. The Tender Executive will be responsible for identifying relevant tenders, preparing comprehensive and ...

Property Manager (Full Time)

📑 Property Manager Residential ComplexLocation: (Insert Location)Reports To: Residents Welfare Association (RWA) / General ManagerObjectiveTo efficiently manage and maintain all operations of a six-building gated residential complex, ensuring seamless facility upkeep, resident satisfaction, vendor efficiency, and ...

System Operator (full Time)

📑 Hiring for 500 systeam operator Jobs in Hyderabad, Karimnagar, Khammam, Kurnool, Nellore, Nizamabad, Ongole, Prakasam, Sambalpur, Tirupati, for Freshers,Required Educational Qualification is : I.T.I., B.A, B.Arch, B.C.A, B.B.A, B.Com, Bachelor of Hotel Management, B.Pharma, B.Sc, LLB with Good knowledge in CCTV ...

Audit Manager (Full Time)

📑 Job DescriptionLocation: Mumbai/Bangalore/Chennai/Kochi/Kolkata/Ahmedabad/Pune/HyderabadAbout the vacancy:2nd Line of Defense 2LoDOur focus continues to be on audit quality underpinned by professional skepticism, independence and strong professional capabilities and this becomes more critical in times such as no ...

Civil Draftsman (Full Time)

📑 !. requires experience in commercial building design2. design in auto cad 3dlocation : ghansolicontract based job name : pooja gurjaremail id :number :Experience 3 - 4 Years No. of Openings 1 Education I.T.I. Role Civil Draftsm ...

VMC Programmer (Full Time)

📑 Job Openings for 2 VMC Programmer Jobs with minimum 1 Year Experience in Kotambi, Vadodara, having Educational qualification of : Diploma with Good knowledge in VMC Machine, Siemens S7, VMC Programmer, Siemens PLC etc. Experience 1 - 2 Years No. of Openings 2 ...

Business Head (Full Time)

📑 Will be responsible for developing business in the security sectorExperience 5 - 10 Years No. of Openings 2 Education Higher Secondary, Diploma, Professional Degree Role Business Head Industry Type Secur ...

Business Specialist (full Time)

📑 The role is of Business Specialist. The candidates have to make plannings and strategies to help make their business grow. They have to talk to clients and help business to grow and also their work is to promote, advertise and the work assigned to them. Experience 0 - 6 Years <p ...

Sales Manager (Full Time)

📑 Work closely & jointly with Defense service employees and business partners to ensure organisation achieves its business aspiration in line with the AOP Targets (New & Customer Retention) as stated in individual objective setting sheets. Support channel partner in delivering higher levels of productivity and fac ...

System Operator (full Time)

📑 Hiring for 500 systeam operator Jobs in Hyderabad, Karimnagar, Khammam, Kurnool, Nellore, Nizamabad, Ongole, Prakasam, Sambalpur, Tirupati, for Freshers,Required Educational Qualification is : I.T.I., B.A, B.Arch, B.C.A, B.B.A, B.Com, Bachelor of Hotel Management, B.Pharma, B.Sc, LLB with Good knowledge in CCTV ...

Computer Programmer (Full Time)

📑 Hands of Programming Language Using Python C #hands of Exp On Reporting Tools like Lasper,Crystal,Sap, Power Bi,Tableaustrong Written and Verbal Communications etc Experience 5 - 8 Years No. of Openings 10 Education B.C.A, B.E, M.B.A/PG ...

Project Manager (Full Time)

📑 Job Summary :We are seeking a detail-oriented and results-driven Project Manager to lead and manage projects from initiation through delivery. The ideal candidate will coordinate internal resources, third parties, and vendors to ensure all aspects of the project are delivered on-time, with ...

Female Telecaller Full Time

📑 We are looking for an enthusiastic and result-driven Tele caller to promote and sell our insurance CRM software solutions. The ideal candidate will have prior experience in telesales or customer support, preferably in the finance or insurance domain.Make outbound calls to potential customers (cold/warm leads) to ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,631,592+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
Exec2 Legacy Stack - Dig - AirBPJio Jio-bp Full time
Lead Engineer - Bluetooth Stack Development Silicon Labs Full time
ShimentoX Technologies- MERN Stack Developer Nexthire Full Time
IN_Manager_Full Stack Lead_Data and A... PwC Full time
Senior Executive_ Engineer_Full... Vodafone Full-time
Application Developer – Microsoft .NET Stack Vrinda International Full-time
Application Developer – Microsoft .NET Stack Vrinda International Full-time
Full-Chip STA Engineer Proxelera Full-time
System Operator (full Time) Right Fit Resources Full-time
Full Time - Sales Consultant Silicon Practice India Full-time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!