📑 CNC,VMC machining operation knowledge. Knowledge of Blackaning, Planting ,Harding. Timely perform as per customers need. Knowledge of Raw material & its grade. Lead the QC team & encourage . Stand with every step of the product process & insure running smooth production process as planned. COPQ reduce,CAPA, 7QC ...
📑 Key Responsibilities:Collect and test influent and treated water samples.Analyze parameters like pH, TDS, TSS, COD, BOD, Oil & Grease, etc.Prepare and maintain chemical solutions for treatment.Adjust chemical dosing as per test results.Maintain laboratory equipment and calibration records.Maintain daily analysis ...
📑 Responsibilities:Understanding Project Requirements: Collaborate with stakeholders to understand project objectives, functional requirements, and design specifications.Conceptual Design and Development: Generate innovative design concepts and solutions that meet project requirements, considering factors such as ...
📑 Dispatch Head Gender : Male Qualification : Diploma in Mechanical Engineering / BE in Mechanical Engineering Designation : Dispatch Head Experience : 4 5 Years Salary Range : 15K to 25K Technical Skills: Proficiency in logistics and dispatch management Strong knowledge of supply chain and logistics operations Ex ...
📑 Property Manager Residential ComplexLocation: (Insert Location)Reports To: Residents Welfare Association (RWA) / General ManagerObjectiveTo efficiently manage and maintain all operations of a six-building gated residential complex, ensuring seamless facility upkeep, resident satisfaction, vendor efficiency, and ...
📑 Field sales by visiting retailers as well as wholesalers at hardwares & sanitaryware shops Experience 0 - 4 Years No. of Openings 1 Education Higher Secondary, Vocational Course, B.B.A, B.Com Role Sales Exe ...
📑 Field sales by visiting retailers as well as wholesalers at hardwares & sanitaryware shops Experience 0 - 4 Years No. of Openings 1 Education Higher Secondary, Vocational Course, B.B.A, B.Com Role Sales Exe ...
📑 Urgent opening For Design Engineer- Nashik - DIPLOMA / BEMale / Female Freshers /Experienced.Sal - 15 K to 35 K Experience 0 - 3 Years No. of Openings 3 Education Diploma, B.E Role Design Engineer </l ...
📑 Job Summary :We are seeking a meticulous and detail-oriented Tender Executive to manage the end-to-end tender process for our (Specify Products/Services) in Nashik and across India. The Tender Executive will be responsible for identifying relevant tenders, preparing comprehensive and ...
📑 Responsibilities:Project Planning and Design: Participate in site investigations, surveys, and data collection. Develop preliminary and detailed designs for civil engineering projects, including roads, bridges, buildings, water supply systems, drainage systems, and other infrastructure.Structural Analysis and De ...
📑 Food Preparation:Assembling food items according to customer orders, ensuring consistency and quality.Cooking food in the oven, monitoring cooking times, and ensuring proper temperature.Customer Service:Taking customer orders online.Answering customer inquiries, making recommendations, and processing transaction ...
📑 Safety: Ensure that construction projects comply with safety regulations and guidelinesProject progress: Monitor the progress of construction projectsWork planning: Help project managers plan the workMaterial management: Manage the orders and deliveries of construction materialsSchedule management: Organize staf ...
📑 JOB DESCRIPTION Req ID: We are currently seeking a Helpdesk Analyst - Full Time to join our team in Noida, Uttar Pradesh (IN-UP), India (IN). In these roles, you will be responsible for: Provide exceptional IT Service Desk support, guidance, and training to end-users for variou ...
📑 Field sales by visiting retailers as well as wholesalers at hardwares & sanitaryware shops Experience 0 - 4 Years No. of Openings 1 Education Higher Secondary, Vocational Course, B.B.A, B.Com Role Sales Exe ...
📑 Field sales by visiting retailers as well as wholesalers at hardwares & sanitaryware shops Experience 0 - 4 Years No. of Openings 1 Education Higher Secondary, Vocational Course, B.B.A, B.Com Role Sales Exe ...
📑 Who's Candidates, Intrested in kitchen work, And Want Carrier in hotel Industry, only those candidates applyExperience 0 - 1 Years No. of Openings 15 Education Secondary School Role Kitchen Helper Industry Type ...
📑 gas fire and multi fuel boiler experience requiredExperience 2 Years No. of Openings 7 Education 12th Pass, 10th Pass, B.E, B.Tech, Post Graduate Diploma Role Boiler Attendant Industry Type Manufacturing ...
📑 Job Responsibilities:Attend customers and assist in salesMaintain shop cleanliness and proper arrangementStock checking and material handlingBasic sales and billing supportDelivery of goods to customers when requiredRequirements:Normal sales skills (training will be provided)Good experience in any sales-related ...
📑 Courier delivery Experience 0 - 1 Years No. of Openings 5 Education Secondary School Role Courier Boy Industry Type Transportation / Logistic / Shipping / Marine / Courier / Fr ...
📑 We have vacant of 189 Marketing Executive Jobs in Gaya, Darbhanga, Kanpur, Lucknow, Gorakhpur, Delhi, Noida, Surat, Hyderabad, Ranchi, for Freshers Educational Qualification : Higher Secondary, Secondary School, Vocational Course, , , , , , Skill Marketing Communication, Marketing, Online Marketing, Basic Comput ...
📑 Job Openings for 1 Mechanical engineer Job with minimum 1 Year Experience in Nashik, having Educational qualification of : Diploma, Professional Degree with Good knowledge in Mechanical engineer etc. Experience 1 - 2 Years No. of Openings 1 Educ ...
📑 Hiring for 1 Cashier Job in Nashik, for Freshers,Required Educational Qualification is : Higher Secondary, Secondary School, , , Other Bachelor Degree with Good knowledge in Cash Handling, Cash Collection, Cashier Activities, Petty Cash Management etc. Experience 0 - 2 Years ...
📑 Skills & Requirements:Sound knowledge in Python (FastAPI)AWSPostgreSQL / SupabaseQueuing systems (Kafka, Airflow)Knowledge in GEN-AI, ML, DL, TensorFlow, PyTorchKey Responsibilities: Write clean, scalable, and efficient codeDevelop back-end components to improve responsiveness and performanceIntegrate user-facin ...
📑 Job Summary : We are seeking a motivated and skilled CFD Engineer with 2 - 4 years of industry experience to join our engineering team. The ideal candidate should have a strong understanding of fluid dynamics and thermal analysis, practical experience with commercial CFD software and the c ...
📑 Tele-caling, voice processExperience 0 - 3 Years No. of Openings 25 Education Higher Secondary Role Telecaller Industry Type Call Centre / BPO / KPO / ITES / LPO Gender ( Male / F ...
📑 taking orders from shopsExperience Fresher No. of Openings 2 Education 10th Pass Role Sales Man Industry Type FMCG / Retail / Food / Beverages Gender ( Male / Female ) < ...
📑 I Need Tele Caller CounsellorExperience 0 - 5 Years No. of Openings 100 Education 12th Pass Role Tele Caller Industry Type Call Centre / BPO / KPO / ITES / LPO Gender ( Male / Fem ...
📑 We are looking for 1 Operation Executive Post in Nashik, with deep knowledge in Documentation, Strategic Communication, Growth Strategy and Required Educational Qualification is : Professional Degree, , , Other Bachelor Degree, Post Graduate Diploma Experience 1 - 2 Years No ...
📑 Hiring for 500 systeam operator Jobs in Hyderabad, Karimnagar, Khammam, Kurnool, Nellore, Nizamabad, Ongole, Prakasam, Sambalpur, Tirupati, for Freshers,Required Educational Qualification is : I.T.I., B.A, B.Arch, B.C.A, B.B.A, B.Com, Bachelor of Hotel Management, B.Pharma, B.Sc, LLB with Good knowledge in CCTV ...
📑 Hands of Programming Language Using Python C #hands of Exp On Reporting Tools like Lasper,Crystal,Sap, Power Bi,Tableaustrong Written and Verbal Communications etc Experience 5 - 8 Years No. of Openings 10 Education B.C.A, B.E, M.B.A/PG ...
📑 Job Summary :We are seeking a detail-oriented and results-driven Project Manager to lead and manage projects from initiation through delivery. The ideal candidate will coordinate internal resources, third parties, and vendors to ensure all aspects of the project are delivered on-time, with ...
📑 We are looking for an enthusiastic and result-driven Tele caller to promote and sell our insurance CRM software solutions. The ideal candidate will have prior experience in telesales or customer support, preferably in the finance or insurance domain.Make outbound calls to potential customers (cold/warm leads) to ...
📑 **PGT Physics Teacher Job Description** We are seeking a dedicated and experienced PGT Physics Teacher to join our institution in Lucknow. The ideal candidate will possess in-depth knowledge of Physics and the ability to teach students at the senior secondary level (Classes XI and XII). Responsibilities include ...
📑 • Extensive knowledge in multiple testbench structures • Knowledge of FPGA and emulation platforms • Proficiency in UVM • PCIe/CXL support and compliance • Knowledge of assertion-based formal verification • A good understanding of the complete verification life cycle (test plan, testbenc ...
📑 We are Hiring for Design Engineerbe Mechanical Malecatia - Ugnx- Autocad- Solid Workfresher 15 Kexperience upto 30 K. Experience 0 - 5 Years No. of Openings 2 Education Diploma, B.E, M.Tech Role Design Engi ...
📑 Hindi,Gujrati lenguage aani chahiyeNo qualification required. Experience Fresher No. of Openings 1 Education Secondary School Role Telecaller Industry Type Call Centre / BPO / ...
📑 • Extensive knowledge in multiple testbench structures • Knowledge of FPGA and emulation platforms • Proficiency in UVM • PCIe/CXL support and compliance • Knowledge of assertion-based formal verification • A good understanding of the complete verification life cycle (test plan, testbenc ...
📑 Work closely & jointly with Defense service employees and business partners to ensure organisation achieves its business aspiration in line with the AOP Targets (New & Customer Retention) as stated in individual objective setting sheets. Support channel partner in delivering higher levels of productivity and fac ...
📑 Hiring for 500 systeam operator Jobs in Hyderabad, Karimnagar, Khammam, Kurnool, Nellore, Nizamabad, Ongole, Prakasam, Sambalpur, Tirupati, for Freshers,Required Educational Qualification is : I.T.I., B.A, B.Arch, B.C.A, B.B.A, B.Com, Bachelor of Hotel Management, B.Pharma, B.Sc, LLB with Good knowledge in CCTV ...
📑 Will be responsible for developing business in the security sectorExperience 5 - 10 Years No. of Openings 2 Education Higher Secondary, Diploma, Professional Degree Role Business Head Industry Type Secur ...
📑 The role is of Business Specialist. The candidates have to make plannings and strategies to help make their business grow. They have to talk to clients and help business to grow and also their work is to promote, advertise and the work assigned to them. Experience 0 - 6 Years <p ...
📑 Job Title: Accounting ExecutiveLocation: Mohali, PunjabDepartment: Accounts & FinanceTiming - 10am - 7pm.Reporting To: Finance Manager / Operations HeadEmployment Type: Full-timeAbout the CompanyWe are an upcoming company in the sexual health domain, building health-tech solutions for various sexual healthand we ...
📑 Hiring for 500 systeam operator Jobs in Hyderabad, Karimnagar, Khammam, Kurnool, Nellore, Nizamabad, Ongole, Prakasam, Sambalpur, Tirupati, for Freshers,Required Educational Qualification is : I.T.I., B.A, B.Arch, B.C.A, B.B.A, B.Com, Bachelor of Hotel Management, B.Pharma, B.Sc, LLB with Good knowledge in CCTV ...
📑 Diploma Civil Engineer- Nashik freshersSite EngineerDIP Civil -MaleExp -Min 6 MSal-Upto 16 K + allowance.Travel JobNashik. Experience 0 - 3 Years No. of Openings 5 Education Diploma, B.E Role Civil Engineer ...
📑 Pizza Delivery boy jobExperience 0 - 1 Years No. of Openings 10 Education Higher Secondary Role Delivery Boy Industry Type FMCG / Food / Beverages Gender Male Job ...
📑 Job Summary:We are looking for a highly skilled Full-Chip Static Timing Analysis (STA) Engineer with 3–6 years of experience in VLSI Physical Design/Timing Closure. The candidate will be responsible for full-chip timing analysis, timing closure, constraint development, and optimization activities across mult ...
📑 We are looking for highly driven builders who love creating scalable products, solving complex challenges and shaping immersive digital experiences.Role OverviewAs a Full Spectrum Product Engineer, you will work across the entire product ecosystem — frontend, backend, APIs, databases, realtime systems an ...
📑 Job Summary :We are seeking a responsible and vigilant Night Administrator to oversee hospital operations during night shifts. The role ensures smooth functioning of clinical and non-clinical services, patient coordination, staff supervision, and adherence to hospital policies during night ...
📑 Video Editor (Full Time) Bahadurgarh, Sonipat Share RSS Feed requirement for Video Editor The Candidate Should be proficient in the following Adobe premier pro Adobe after effect Adobe photoshop Adobe Illustrator Knowledge of coral draw will be plus point ...
📑 Assisting Architects in architectural design drafting, preparation of municipal submission and completion drawing, preparing conceptual presentation drawing, detailed working drawing, preparing consultants drawing incorporation etc.Experience 2 - 8 Years No. of Openings 2 </ ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,631,745+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| QC Manager - Full Time | Haimy Counsultancy | Full-time |
| ETP Chemist - Full Time | TDS Placements and Services Private Limited | Full-time |
| Design Engineer (Full Time) | Placement India | Full-time |
| Dispatch Executive (Full Time) | Placement India | Full-time |
| Property Manager (Full Time) | Acme Ozone Coop Societies Federation Ltd | Full-time |
| Sales Executive (Full Time) | Mohammedi Polytech | Full-time |
| Sales Executive (Full Time) | Mohammedi Polytech | Full-time |
| Design Engineer (Full Time) | Placement India | Full-time |
| Tender Executive (Full Time) | Placement India | Full-time |
| Civil Engineer (Full Time) | Placement India | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!