📑 We're Hiring: SEO Marketing Solutions, TrivandrumIf you live and breathe search rankings, know your way around a technical audit, and want to do meaningful work at a growing performance marketing agency — read on.About UsAdvantage Marketing Solutions is a performance marketing and branding agency b ...
📑 At Arctic Wolf, you won’t just watch the cybersecurity industry evolve – you'll help lead the change. Our global Pack is made up of people who thrive on solving hard problems, moving fast, and building technology that protects organizations around the world. We’re proud to be recognized by Forbes, CNBC, Fortu ...
📑 At Arctic Wolf, you won’t just watch the cybersecurity industry evolve – you'll help lead the change. Our global Pack is made up of people who thrive on solving hard problems, moving fast, and building technology that protects organizations around the world. We’re proud to be recognized by Forbes, CNBC, Fortu ...
📑 At EY, we’re all in to shape your future with confidence. We’ll help you succeed in a globally connected powerhouse of diverse teams and take your career wherever you want it to go. Join EY and help to build a better working world. Career Family DE TechOps <b ...
📑 At Arctic Wolf, you won’t just watch the cybersecurity industry evolve – you'll help lead the change. Our global Pack is made up of people who thrive on solving hard problems, moving fast, and building technology that protects organizations around the world. We’re proud to be recognized by Forbes, CNBC, Fortu ...
📑 At EY, we’re all in to shape your future with confidence. We’ll help you succeed in a globally connected powerhouse of diverse teams and take your career wherever you want it to go. Join EY and help to build a better working world. Career Family DE TechOps <b ...
📑 At Arctic Wolf, you won’t just watch the cybersecurity industry evolve – you'll help lead the change. Our global Pack is made up of people who thrive on solving hard problems, moving fast, and building technology that protects organizations around the world. We’re proud to be recognized by Forbes, CNBC, Fortu ...
📑 Good to have skills: Git Jenkins Apache Kafka Azure Cloud ELK stack TDD & BDD Containerization like Kubernetes/Docker Experience with GitHub CoPilot (nice to have) Must have skills for all roles: Java V17+ ...
📑 Job Title:Sr. Developer I - IT MES & Plant Automation (Java/J2EE)Summary:We are seeking a passionate and highly skilled Java Full Stack Developer to join our global IT development and operations team. In this role, you will design, develop, enhance, and sup ...
📑 FINANCE | Corporate Treasury We're a team of specialists charged with managing the firm’s funding, liquidity, capital and relationships with creditors and regulators. Corporate Treasury manages the firm’s financial resources and minimizes interest expense through liability planning, asset liability management, a ...
📑 Job ObjectiveDesign, build, and maintain end‑to‑end application components—covering both front-end user experiences and backend services—to deliver reliable, scalable, and secure digital products.This role focuses on developing production-ready Python FastAPI ...
📑 Description We're seeking an exceptional Software Engineers to drive the development of cutting-edge artificial intelligence enabled solutions. As a key member of our Asset Management Engineering team, you'll shape the future of investment management by developing and deploying innovative AI ...
📑 About NetskopeToday, there's more data and users outside the enterprise than inside, causing the network perimeter as we know it to dissolve. We realized a new perimeter was needed, one that is built in the cloud and follows and protects data wherever it goes, so we started Netskop ...
📑 Job Description: Assistant Vice President (AVP) – AI Engineering & Solutions Location: BengaluruAbout us Algebrik AI, headquartered in New York City is the world's first cloud-native and AI-p ...
📑 Job Title:Sr. Developer I - Enterprise Technology & Analytics (Java/J2EE)Summary:We are seeking a passionate and highly skilled Java Full Stack Developer to join our global IT development and operations team. In this role, you will design, develop, enhance, ...
📑 The OpportunityWe are looking for a Senior User Experience Engineer (MTS4) to join our UX/UI team. You will work at the intersection of design and technology — collaborating with designers, researchers, and engineers to prototype, validate, and deliver great user experiences across Nutani ...
📑 FINANCE | Corporate Treasury We're a team of specialists charged with managing the firm’s funding, liquidity, capital and relationships with creditors and regulators. Corporate Treasury manages the firm’s financial resources and minimizes interest expense through liability planning, asset liability management, a ...
📑 Job Description: Assistant Vice President (AVP) – AI Engineering & Solutions Location: Bengaluru About us Algebrik AI, headquartered in New York City is the world's first cloud-native and AI-power ...
📑 Job Objective Design, build, and maintain end‑to‑end application components—covering both front-end user experiences and backend services —to deliver reliable, scalable, and secure digital products.This role focuses on developing production-ready Python Fa ...
📑 About Netskope Today, there's more data and users outside the enterprise than inside, causing the network perimeter as we know it to dissolve. We realized a new perimeter was needed, one that is built in the cloud and follows and protects data wherever it goes, so we started Net ...
📑 Description We're seeking an exceptional Software Engineers to drive the development of cutting-edge artificial intelligence enabled solutions. As a key member of our Asset Management Engineering team, you'll shape the future of investment management by developing and deploying innovative ...
📑 Job Title: Sr. Developer I - IT MES & Plant Automation (Java/J2EE)Summary: We are seeking a passionate and highly skilled Java Full Stack Developer to join our global IT development and operations team. In this role, you will design, develop, enhance, ...
📑 ABOUT US , part of Capgemini, tackles the hardest work in data for the world’s largest organizations. We combine intelligent software with deep data expertise to help the Fortune2000 tackle complex data challenges and drive measurable business outcomes with business-ready data. ...
📑 Job Title: Sr. Developer I - Enterprise Technology & Analytics (Java/J2EE)Summary: We are seeking a passionate and highly skilled Java Full Stack Developer to join our global IT development and operations team. In this role, you will design, develop, ...
📑 FINANCE | Corporate Treasury We're a team of specialists charged with managing the firm’s funding, liquidity, capital and relationships with creditors and regulators. Corporate Treasury manages the firm’s financial resources and minimizes interest expense through liability planning, asset liability management, a ...
📑 The Opportunity We are looking for a Senior User Experience Engineer (MTS4) to join our UX/UI team. You will work at the intersection of design and technology — collaborating with designers, researchers, and engineers to prototype, validate, and deliver great user experiences across Nut ...
📑 FINANCE | Corporate Treasury We're a team of specialists charged with managing the firm’s funding, liquidity, capital and relationships with creditors and regulators. Corporate Treasury manages the firm’s financial resources and minimizes interest expense through liability planning, asset liability management, a ...
📑 Role Summary The Forward Deployed Engineer (FDE) sits at the intersection of AI engineering and client delivery. This is a hands-on, client-facing technical role responsible for architecting and building customized agentic solutions directly within client environments. The FDE does not hand off work ...
📑 NTRODUCTION TO EVERNORTH: Evernorth Health Services India, established in Hyderabad in 2024, is an innovation hub for Evernorth Health Services, the pharmacy, care and benefits division of The Cigna Group. The innovation hub will support innovation-focused areas, such as generative AI, product development, proce ...
📑 HARMAN’s engineers and designers are creative, purposeful and agile. As part of this team, you’ll combine your technical expertise with innovative ideas to help drive cutting-edge solutions in the car, enterprise and connected ecosystem. Every day, you will push the boundaries of creative design, and HA ...
📑 Job DescriptionWe are seeking a Software Engineering Manager based in Pune with a strong background in software development to lead our newly built Data Applications Engineering team. This team sits under the Enterprise Data & Analytics (EDA) ...
📑 HARMAN’s engineers and designers are creative, purposeful and agile. As part of this team, you’ll combine your technical expertise with innovative ideas to help drive cutting-edge solutions in the car, enterprise and connected ecosystem. Every day, you will push the boundaries of creative design, and HA ...
📑 Sr. DeveloperWe are looking for a highly skilled computer programmer who is comfortable with both front and back end programming. Full stack developers are responsible for developing and designing front end web architecture ensuring the responsiveness of applications and working alongside graphi ...
📑 Candidate should be able to: Deliver software in an agile environment, continuously Deliver GoLang based microservices into a Kubernetes based, web-scale environment Drive a customer-centric, highly personalized approach to the evolution of our platform Build the middleware for client appl ...
📑 Candidate should be able to: Deliver software in an agile environment, continuously Deliver GoLang based microservices into a Kubernetes based, web-scale environment Drive a customer-centric, highly personalized approach to the evolution of our platform Build the middleware for client appl ...
📑 Candidate should be able to: Deliver software in an agile environment, continuously Deliver GoLang based microservices into a Kubernetes based, web-scale environment Drive a customer-centric, highly personalized approach to the evolution of our platform Build the middleware for client appl ...
📑 Candidate should be able to: Deliver software in an agile environment, continuously Deliver GoLang based microservices into a Kubernetes based, web-scale environment Drive a customer-centric, highly personalized approach to the evolution of our platform Build the middleware for client appl ...
📑 Candidate should be able to: Deliver software in an agile environment, continuously Deliver GoLang based microservices into a Kubernetes based, web-scale environment Drive a customer-centric, highly personalized approach to the evolution of our platform Build the middleware for client appl ...
📑 Job Title: Enterprise Architect Experience: 18+ years Location: Chn/Hyd/Blg/Pune Domain: Banking Notice Period: Immediate to 45 days Job Description: < ...
📑 Candidate should be able to: Deliver software in an agile environment, continuously Deliver GoLang based microservices into a Kubernetes based, web-scale environment Drive a customer-centric, highly personalized approach to the evolution of our platform Build the middleware for client appl ...
📑 Candidate should be able to: Deliver software in an agile environment, continuously Deliver GoLang based microservices into a Kubernetes based, web-scale environment Drive a customer-centric, highly personalized approach to the evolution of our platform Build the middleware for client appl ...
📑 Candidate should be able to: Deliver software in an agile environment, continuously Deliver GoLang based microservices into a Kubernetes based, web-scale environment Drive a customer-centric, highly personalized approach to the evolution of our platform Build the middleware for client appl ...
📑 Job Title: Enterprise Architect Experience: 18+ years Location: Chn/Hyd/Blg/Pune Domain: Banking Notice Period: Immediate to 45 days Job Description: Must be skilled in Java stack, Front end stack and op ...
📑 Candidate should be able to: Deliver software in an agile environment, continuously Deliver GoLang based microservices into a Kubernetes based, web-scale environment Drive a customer-centric, highly personalized approach to the evolution of our platform Build the middleware for client appl ...
📑 Candidate should be able to: Deliver software in an agile environment, continuously Deliver GoLang based microservices into a Kubernetes based, web-scale environment Drive a customer-centric, highly personalized approach to the evolution of our platform Build the middleware for client appl ...
📑 Job Title: Enterprise Architect Experience: 18+ years Location: Chn/Hyd/Blg/Pune Domain: Banking Notice Period: Immediate to 45 days Job Description: </ ...
📑 Job Title: Enterprise Architect Experience: 18+ years Location: Chn/Hyd/Blg/Pune Domain: Banking Notice Period: Immediate to 45 days Job Description: < ...
📑 Who are we and what do we do?Browser Stack is the world’s leading cloud-based software testing platform, empowering over 50,000 customers—including Amazon, Microsoft, Meta, and Google—to deliver high-quality software at speed. Founded in 2011 by Ritesh Arora and Nakul Aggarwal, the company has grown to suppo ...
📑 GROW10X is a leading full-service agency specializing in helping B2B SaaS technology companies accelerate revenue growth through outbound lead generation. Utilizing a combination of cutting-edge technology, expert strategies, on-demand data, and a globally distributed team, GROW10X is dedicated to delivering ...
📑 Job Description We are looking for a Software Engineer with experience in DB2 on the iSeries (AS/400) platform to support our modernization initiatives. This role will primarily focus on reverse engineering and analyzing existing iSeries applications, documenting current system functionality, and ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 916,731+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Search engine optimization specialist | Advantage Marketing Solutions | Full-time |
| Senior Developer 1 | Arctic Wolf | Full-time |
| Senior Developer 2 - Backend | Arctic Wolf | Full time |
| TechOps-DE-Architect-Manager | EY | Full-time |
| Senior Developer 1 | Arctic Wolf | Full-time |
| TechOps-DE-Architect-Manager | WomenTech Network | Full-time |
| Senior Developer 2 - Backend | Arctic Wolf | Full-time |
| Senior Software Engineer -Java-Bangalore | Photon | Full-time |
| Sr. Developer I - IT MES & Plant... | Momentive | Full time |
| Corporate... | Goldman Sachs | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!