📑 Greetings from SigiloTech ! Apply only if you are form Kolkata. Are you a passionate problem-solver with a knack for coding? Whether you’re a fresher or have experience, if you hold a B.Sc or M.Sc in a relevant field, we’re looking for YOU! AP ...
📑 DescriptionThe recruiter will be responsible for all levels of talent acquisition, recruiting, and recruitment programs, procedures, and plans. Serve as consultant and partner staying current on business and market trends, assisting on both the strategic and tactical level. Possesses strong understanding of ...
📑 DescriptionImagine being at the forefront of Amazon's relentless pursuit of exceptional talent. As a Full Lifecycle Recruiter, you'll rub shoulders with the brightest minds in the industry and be the driving force behind building high-performing teams that shape the future of e-commerce and customer experien ...
📑 Technical Lead - JavaScript fullstack IT (Information Technology) Permanent contract Bangalore, India Hybrid Reference 25000D1S Start date Immediately Publication date 2025/09/21 Responsibilities Job Description: Full Stack JavaScript Developer (React & ...
📑 Technical Lead - JavaScript fullstack IT (Information Technology) Permanent contract Bangalore, India Hybrid Reference 25000D1S Start date Immediately Publication date 2025/09/21 Responsibilities Job Description: Full Stack JavaScript Developer (React & ...
📑 Overview Lead a client project. Goal is to structure & coordinate the activities of a team of consultants and/or associates in developing a coherent strategy, together with the client. Key role in maintaining & reinforcing client relationships. Seen by client as business advisor in ...
📑 Overview Lead a client project. Goal is to structure & coordinate the activities of a team of consultants and/or associates in developing a coherent strategy, together with the client. Key role in maintaining & reinforcing client relationships. Seen by client as business advisor ...
📑 Role: Staff Engineer (Backend/Full Stack)Esops : 1 Cr -3 Cr INRSalary : No BarLocation: BengaluruWork Type: Full-TimeExperience: 6–10 YearsDomain: AI/ML / Backend / Full Stack EngineeringPinegapPinegap is ...
📑 Experience : 12-15Yrs Location : Hyderabad Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadership roles ...
📑 Experience : 12-15Yrs Location : Bangalore Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadership roles ...
📑 Experience : 12-15Yrs Location : Bangalore Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadership roles ...
📑 Experience : 12-15Yrs Location : Hyderabad Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leader ...
📑 Experience : 12-15Yrs Location : Hyderabad Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leader ...
📑 Experience : 12-15Yrs Location : Bangalore Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leader ...
📑 Experience : 12-15Yrs Location : Bangalore Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leader ...
📑 Experience : 12-15YrsLocation : BangaloreNotice period: immediate to 30daysNote: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadership ...
📑 Experience : 12-15YrsLocation : BangaloreNotice period: immediate to 30daysNote: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadership roles, in ...
📑 Experience : 12-15Yrs Location : Hyderabad Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadership roles ...
📑 Experience : 12-15YrsLocation : BangaloreNotice period: immediate to 30daysNote: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadersh ...
📑 Experience : 12-15Yrs Location : Hyderabad Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into lea ...
📑 Experience : 12-15Yrs Location : Bangalore Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into lea ...
📑 Experience : 12-15YrsLocation : BangaloreNotice period: immediate to 30daysNote: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadership ...
📑 Experience : 12-15Yrs Location : Hyderabad Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadership roles ...
📑 Experience : 12-15YrsLocation : HyderabadNotice period: immediate to 30daysNote: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadersh ...
📑 Experience : 12-15YrsLocation : HyderabadNotice period: immediate to 30daysNote: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadership roles, in ...
📑 Experience : 12-15YrsLocation : BangaloreNotice period: immediate to 30daysNote: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadership roles, in ...
📑 Experience : 12-15Yrs Location : Bangalore Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadership roles ...
📑 Experience : 12-15YrsLocation : HyderabadNotice period: immediate to 30daysNote: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadersh ...
📑 Experience : 12-15YrsLocation : HyderabadNotice period: immediate to 30daysNote: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadersh ...
📑 Experience : 12-15Yrs Location : Hyderabad Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leader ...
📑 Experience : 12-15YrsLocation : BangaloreNotice period: immediate to 30daysNote: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadersh ...
📑 Experience : 12-15Yrs Location : Bangalore Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadership roles ...
📑 Experience : 12-15Yrs Location : Bangalore Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leader ...
📑 Experience : 12-15YrsLocation : HyderabadNotice period: immediate to 30daysNote: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadership ...
📑 Experience : 12-15Yrs Location : Bangalore Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadership roles ...
📑 Experience : 12-15YrsLocation : BangaloreNotice period: immediate to 30daysNote: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadersh ...
📑 Experience : 12-15YrsLocation : HyderabadNotice period: immediate to 30daysNote: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadersh ...
📑 Experience : 12-15YrsLocation : BangaloreNotice period: immediate to 30daysNote: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadersh ...
📑 Experience : 12-15Yrs Location : Bangalore Notice period: immediate to 30days Note: Seeking candidates strictly from a development background. The ideal candidate should have hands-on experience as a developer in the past and should have progressed into leadership roles ...
📑 Job Description Java / Full Stack DeveloperPosition: Java / Full Stack Developer Location: Pune (Hinjewadi / Kharadi) Hybrid Employment Type: Contract (C2C 12 Months) Experience: Minimum 5 ye ...
📑 Join Naresh I Technologies, an esteemed leader in technical and vocational training located in Ameerpet, Hyderabad. We are seeking a dedicated Data Science Trainer to be part of our dynamic team. With a focus on fostering a comprehensive learning experience, you will have the opportunity to shape the future o ...
📑 Join Naresh I Technologies, an esteemed leader in technical and vocational training located in Ameerpet, Hyderabad. We are seeking a dedicated Data Science Trainer to be part of our dynamic team. With a focus on fostering a comprehensive learning experience, you will have the opportunity to shape the future o ...
📑 Job Description Java / Full Stack Developer Position: Java / Full Stack Developer Location: Pune (Hinjewadi / Kharadi) Hybrid Employment Type: Contract (C2C 12 Months) Experience: Min ...
📑 Job Details Requirement Type Permanent Job Title .Net Desktop Application Developer Job Level Middle Management Job Description No. of Openings 6 Job Domain IT Experience - Minimum - Maximum / BCA Specialisation Skills C# .NET Software Developer, C#, WPF, WinForms, Full Stack .NET ...
📑 Hiring for computer teacher full time ,Amritsar {oo11806), Kindlye send you Bio Data / Resume at 77103-78047 by WAQualification - Graduation, fresher can also apply, communication skill must required, only female staff required, Salary 15000 to 20000 per month, , send you Bio Data / Resume at 7710378047 by WA ...
📑 Hiring for computer teacher full time ,Amritsar {oo24568), Kindlye send you Bio Data / Resume at 77103-78047 by WAQualification - Graduation, fresher can also apply, communication skill must required, only female staff required, Salary 15000 to 20000 per month, , send you Bio Data / Resume at 7710378047 by WA ...
📑 Hiring for computer teacher full time ,Amritsar {oo30949), Kindlye send you Bio Data / Resume at 77103-78047 by WAQualification - Graduation, fresher can also apply, communication skill must required, only female staff required, Salary 15000 to 20000 per month, , send you Bio Data / Resume at 7710378047 by WA ...
📑 Hiring for computer teacher full time ,Amritsar {oo30949), Kindlye send you Bio Data / Resume at 77103-78047 by WAQualification - Graduation, fresher can also apply, communication skill must required, only female staff required, Salary 15000 to 20000 per month, , send you Bio Data / Resume at 7710378047 by WA ...
📑 Hiring for computer teacher full time ,Amritsar {oo37330), Kindlye send you Bio Data / Resume at 77103-78047 by WAQualification - Graduation, fresher can also apply, communication skill must required, only female staff required, Salary 15000 to 20000 per month, , send you Bio Data / Resume at 7710378047 by WA ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,631,463+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Entry-Level Software Developer... | SigiloTech | Full-time |
| Full Lifecycle Recruiter-I, Amazon... | Amazon | Full-time |
| Full Lifecycle Recruiter II, Amazon... | Amazon | Full-time |
| Technical Lead - JavaScript fullstack | Société Générale Assurances | Permanent contract |
| Technical Lead - JavaScript fullstack | Société Générale Assurances | Full-time |
| Consultant (Japanese Language... | Frost & Sullivan | Full-time |
| Consultant (Japanese Language... | Frost & Sullivan | Full-time |
| Staff Engineer | Pinegap | FULLTIME |
| Delivery Manager | Grid Dynamics | Full-time |
| Delivery Manager | Grid Dynamics | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!