📑 DescriptionThe recruiter will be responsible for all levels of talent acquisition, recruiting, and recruitment programs, procedures, and plans. Serve as consultant and partner staying current on business and market trends, assisting on both the strategic and tactical level. Possesses strong understanding of ...
📑 • DevOps – a full stack development and operations team member who is fluent in Kubernetes, basic network engineering, microservice development/architecture, build pipelines, enterprise development, automation, security, and threat modeling, vulnerability mitigations, web application firewalls, static resource c ...
📑 • DevOps – a full stack development and operations team member who is fluent in Kubernetes, basic network engineering, microservice development/architecture, build pipelines, enterprise development, automation, security, and threat modeling, vulnerability mitigations, web application firewalls, static resource c ...
📑 • DevOps – a full stack development and operations team member who is fluent in Kubernetes, basic network engineering, microservice development/architecture, build pipelines, enterprise development, automation, security, and threat modeling, vulnerability mitigations, web application firewalls, static resource c ...
📑 • DevOps – a full stack development and operations team member who is fluent in Kubernetes, basic network engineering, microservice development/architecture, build pipelines, enterprise development, automation, security, and threat modeling, vulnerability mitigations, web application firewalls, static resource c ...
📑 • DevOps – a full stack development and operations team member who is fluent in Kubernetes, basic network engineering, microservice development/architecture, build pipelines, enterprise development, automation, security, and threat modeling, vulnerability mitigations, web application firewalls, static resource c ...
📑 • DevOps – a full stack development and operations team member who is fluent in Kubernetes, basic network engineering, microservice development/architecture, build pipelines, enterprise development, automation, security, and threat modeling, vulnerability mitigations, web application firewalls, static resource c ...
📑 • DevOps – a full stack development and operations team member who is fluent in Kubernetes, basic network engineering, microservice development/architecture, build pipelines, enterprise development, automation, security, and threat modeling, vulnerability mitigations, web application firewalls, static resource c ...
📑 • DevOps – a full stack development and operations team member who is fluent in Kubernetes, basic network engineering, microservice development/architecture, build pipelines, enterprise development, automation, security, and threat modeling, vulnerability mitigations, web application firewalls, static resource c ...
📑 • DevOps – a full stack development and operations team member who is fluent in Kubernetes, basic network engineering, microservice development/architecture, build pipelines, enterprise development, automation, security, and threat modeling, vulnerability mitigations, web application firewalls, static resource c ...
📑 • DevOps – a full stack development and operations team member who is fluent in Kubernetes, basic network engineering, microservice development/architecture, build pipelines, enterprise development, automation, security, and threat modeling, vulnerability mitigations, web application firewalls, static resource c ...
📑 Job DescriptionHere is a maximum-scale, stress-test job description designed to evaluate your system's edge cases. This template tests multiple corner cases simultaneously: extreme length/word count, deeply nested hierarchical formatting, intensive use of special cha ...
📑 Job DescriptionHere is a maximum-scale, stress-test job description designed to evaluate your system's edge cases.This template tests multiple corner cases simultaneously: extreme length/word count, deeply nested hierarchical formatting, intensive use of special chara ...
📑 Role: SDE 3 Location: Bengaluru Work Type: Full-Time Experience: 5–7Years Domain: AI/ML / Backend / Full Stack Engineering Pinegap Pinegap is building AI agents for Wall Street funds focused on fundamental equity ...
📑 About Company: It is one of the world's leading global banks, providing commercial banking, corporate finance, investment banking, and financial services Location: Chennai Experience: 8–12 Years ⏳ Notice Period: Immediate to 30 Days < ...
📑 About Company: It is one of the world's leading global banks, providing commercial banking, corporate finance, investment banking, and financial services Location: Chennai Experience: 8 12 Years Notice Period: ...
📑 About Company: It is one of the world's leading global banks, providing commercial banking, corporate finance, investment banking, and financial services Location: Chennai Experience: 8 12 Years Notice Period:</stro ...
📑 About Company:It is one of the world's leading global banks, providing commercial banking, corporate finance, investment banking, and financial services📍 Location: Chennai💼 Experience: 8–12 Years⏳ Notice Period: Immediate to 30 Days R ...
📑 CU invites applications for full-time faculty positions in Computer Science Engineering-APEX To teach undergraduate and graduate Engineering courses in the respective discipline(s) at CU.Scholarship and research leading to journal publications are expected and required for tenure consider ...
📑 CU invites applications for full-time faculty positions in Computer Science Engineering-APEX To teach undergraduate and graduate Engineering courses in the respective discipline(s) at CU.Scholarship and research leading to journal publications are expected and required for tenure consider ...
📑 CU invites applications for full-time faculty positions in Computer Science Engineering-APEX To teach undergraduate and graduate Engineering courses in the respective discipline(s) at CU.Scholarship and research leading to journal publications are expected and required for tenure consider ...
📑 CU invites applications for full-time faculty positions in Computer Science Engineering-APEX To teach undergraduate and graduate Engineering courses in the respective discipline(s) at CU. Scholarship and research leading to journal publications are expected and required for tenure consi ...
📑 Overview Lead a client project. Goal is to structure & coordinate the activities of a team of consultants and/or associates in developing a coherent strategy, together with the client. Key role in maintaining & reinforcing client relationships. Seen by client as business advisor ...
📑 Overview Lead a client project. Goal is to structure & coordinate the activities of a team of consultants and/or associates in developing a coherent strategy, together with the client. Key role in maintaining & reinforcing client relationships. Seen by client as business advisor in ...
📑 Role- Team Lead Full stack Location- Pune Work Mode- 5 days WFOWe are looking for an experienced Full Stack Team Lead with deep technical expertise in React.js (frontend) and Node.js (backend) to lead software development efforts for enterprise-scale digital systems. The ideal candidate w ...
📑 Role Overview We are seeking a Intern - Shopify Developer with a solid foundation in frontend technologies and a basic understanding of backend architecture. The role focuses on building, enhancing, and maintaining eCommerce web applications, with exposure to Shopify and modern full-stack technologies such as Re ...
📑 This job is with Accenture, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Project Role :Software Development EngineerProject Role Description :Analyze, design, code and ...
📑 This job is with Accenture, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Project Role :Software Development EngineerProject Role Description :Analyze, design, code and ...
📑 This job is with Accenture, an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly.Project Role :Application DeveloperProject Role Description :Design, build and configure applic ...
📑 Summary A hands-on Full Stack Data Engineer responsible for designing, building, and optimizing scalable Microsoft Fabric-based data and analytics solutions. The role requires expertise across data engineering, cloud integration, AI-assisted development, and lightweight application integration, with a focus on r ...
📑 Applications should be submitted to: JOB DESCRIPTION Full Stack Engineer (MEAN Stack) Department Technology Location Pune (Onsite, Full-Time) Reports ...
📑 Applications should be submitted to: JOB DESCRIPTION Full Stack Engineer (MEAN Stack) Department Technology Location Pune (Onsite, Full-Time) Reports to Technology Lead Team Individual ...
📑 Applications should be submitted to: JOB DESCRIPTION Full Stack Engineer (MEAN Stack) Department Technology Location Pune (Onsite, Full-Time) Reports to Technology Lead Team Individual ...
📑 Applications should be submitted to: JOB DESCRIPTION Full Stack Engineer (MEAN Stack) Department Technology Location Pune (Onsite, Full-Time) Reports ...
📑 Applications should be submitted to: JOB DESCRIPTION Full Stack Engineer (MEAN Stack) Department Technology Location Pune (Onsite, Full-Time) <strong ...
📑 Applications should be submitted to: DESCRIPTIONFull Stack Engineer (MEAN Stack)DepartmentTechnologyLocationPune (Onsite, Full-Time)Reports toTechnology LeadTeamIndividual Contributor<b ...
📑 Applications should be submitted to: DESCRIPTIONFull Stack Engineer (MEAN Stack)Department TechnologyLocation P ...
📑 Applications should be submitted to: DESCRIPTIONFull Stack Engineer (MEAN Stack)DepartmentTechnologyLocationPune (Onsite, Full-Time)Reports toTechnology LeadTeamIndividual Contributor<b ...
📑 Applications should be submitted to: JOB DESCRIPTION Full Stack Engineer (MEAN Stack) Department Technology Location Pune (Onsite, Full-Time) Reports to Technology Lead Team Individual ...
📑 Applications should be submitted to: DESCRIPTIONFull Stack Engineer (MEAN Stack)Department TechnologyLocation Pune (Onsite, Full-Time)Reports to Technology L ...
📑 Applications should be submitted to: JOB DESCRIPTION Full Stack Engineer (MEAN Stack) Department Technology Location Pune (Onsite, Full-Time) Reports ...
📑 Project Role : Custom Software EngineerProject Role Description : Lead the effort to design, build and configure applications, acting as the primary point of contact.Must have skills : .Net Full Stack DevelopmentGood to have skills : NAMinimum 5 year(s) of experience is requiredEducational Qualification : 15 yea ...
📑 Hiring for computer teacher full time ,Amritsar {oo11806), Kindlye send you Bio Data / Resume at 77103-78047 by WAQualification - Graduation, fresher can also apply, communication skill must required, only female staff required, Salary 15000 to 20000 per month, , send you Bio Data / Resume at 7710378047 by WA ...
📑 Hiring for computer teacher full time ,Amritsar {oo24568), Kindlye send you Bio Data / Resume at 77103-78047 by WAQualification - Graduation, fresher can also apply, communication skill must required, only female staff required, Salary 15000 to 20000 per month, , send you Bio Data / Resume at 7710378047 by WA ...
📑 Hiring for computer teacher full time ,Amritsar {oo30949), Kindlye send you Bio Data / Resume at 77103-78047 by WAQualification - Graduation, fresher can also apply, communication skill must required, only female staff required, Salary 15000 to 20000 per month, , send you Bio Data / Resume at 7710378047 by WA ...
📑 Hiring for computer teacher full time ,Amritsar {oo30949), Kindlye send you Bio Data / Resume at 77103-78047 by WAQualification - Graduation, fresher can also apply, communication skill must required, only female staff required, Salary 15000 to 20000 per month, , send you Bio Data / Resume at 7710378047 by WA ...
📑 Hiring for computer teacher full time ,Amritsar {oo37330), Kindlye send you Bio Data / Resume at 77103-78047 by WAQualification - Graduation, fresher can also apply, communication skill must required, only female staff required, Salary 15000 to 20000 per month, , send you Bio Data / Resume at 7710378047 by WA ...
📑 Hiring for computer teacher full time ,Amritsar {oo43711), Kindlye send you Bio Data / Resume at 77103-78047 by WAQualification - Graduation, fresher can also apply, communication skill must required, only female staff required, Salary 15000 to 20000 per month, , send you Bio Data / Resume at 7710378047 by WA ...
📑 Hiring for computer teacher full time ,Amritsar {oo5425), Kindlye send you Bio Data / Resume at 77103-78047 by WAQualification - Graduation, fresher can also apply, communication skill must required, only female staff required, Salary 15000 to 20000 per month, , send you Bio Data / Resume at 7710378047 by WA ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,631,578+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Full Lifecycle Recruiter-I, Amazon... | Amazon | Full-time |
| Fullstack Developer - IBM Cloud | Anicalls (Pty) Ltd | Full-time |
| Fullstack -Console | Anicalls (Pty) Ltd | Full-time |
| Fullstack - IBM Cloud Console | Anicalls (Pty) Ltd | Full-time |
| Fullstack - IBM Console | Anicalls (Pty) Ltd | Full-time |
| IBM Cloud Console | Anicalls (Pty) Ltd | Full-time |
| Fullstack Developer - IBM Cloud | Anicalls (Pty) Ltd | Full Time/Permanent |
| IBM Cloud Console | Anicalls (Pty) Ltd | Full Time/Permanent |
| Fullstack - IBM Cloud Console | Anicalls (Pty) Ltd | Full Time/Permanent |
| Fullstack -Console | Anicalls (Pty) Ltd | Full Time/Permanent |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!