📑 Purchasing / Import / Export Administrator | Part-time or Full-time | South East Melbourne | Temp to Perm opportunity South Eastern SuburbsTemp to perm opportunity (start as a 4 month contract)Part-ti ...
📑 Job Summary About the role: As a Architect , you will lead the definition, governance, and continuous evolution of the enterprise data architecture vision and roadmap, ensuring strong alignment with business strategy and digital transformation goa ...
📑 Job Title: Lead Consultant - AI Application Engineering Career Level: E Location: Bangalore Introduction to role: Are you ready to turn modern AI into reliable, scalable applications that help accelerate the discovery and delivery of life-cha ...
📑 Branch Overview Branch is a leading AI-powered lending fintech with 50M+ downloads across India and Africa. We use alternative data and machine learning to expand financial access for millions of people traditionally excluded from the formal financial system. Founded by the former CEO of Kiva. ...
📑 INTRODUCTION TO EVERNORTH: Evernorth Health Services India, established in Hyderabad in 2024, is an innovation hub for Evernorth Health Services, the pharmacy, care and benefits division of The Cigna Group. The innovation hub will support innovation-focused areas, such as generative AI, produc ...
📑 Join us as we work to create a thriving ecosystem that delivers accessible, high-quality, and sustainable healthcare for all. Role summary Build scalable, reliable full-stack capabilities that help simplify clinical documentation and support smoother provider workflows. In this role, you ...
📑 Lead Software Engineer (Full Stack, Java, AWS) Location: Vashi, Navi Mumbai The Role: At Morningstar, helping investors is what brings us together and drives our work. We are looking for a Lead Software Engineer who combines deep technical expertise with strong ownership ...
📑 Assistant Architect-Blockchain (Associate Architect)_2539 Overall Objectives of Job As a Full Stack Lead, you will be a key technical leader responsible for guiding development teams, architecting scalable enterprise solutions, and ensuring successful delivery of complex web ...
📑 Job Summary Synechron is seeking a skilled Java Fullstack Developer to design, develop, and maintain scalable, high-performance web applications. This role involves working across the entire software development lifecycle, enabling seamless integration between front-end and back-end components. ...
📑 INTRODUCTION TO EVERNORTH: Evernorth Health Services India, established in Hyderabad in 2024, is an innovation hub for Evernorth Health Services, the pharmacy, care and benefits division of The Cigna Group. The innovation hub will support innovation-focused areas, such as generative AI, product ...
📑 Join us as we work to create a thriving ecosystem that delivers accessible, high-quality, and sustainable healthcare for all.Role summaryBuild scalable, reliable full-stack capabilities that help simplify clinical documentation and support smoother provider workflows. In this role, you wi ...
📑 Job Title: Lead Consultant - AI Application EngineeringCareer Level: ELocation: BangaloreIntroduction to role:Are you ready to turn modern AI into reliable, scalable applications that help accelerate the discovery and delivery of life-changing med ...
📑 Job Summary About the role: As a Architect, you will lead the definition, governance, and continuous evolution of the enterprise data architecture vision and roadmap, ensuring strong alignment with business strategy and digital transformation goals. This ...
📑 Lead Software Engineer (Full Stack, Java, AWS)Location: Vashi, Navi MumbaiThe Role: At Morningstar, helping investors is what brings us together and drives our work. We are looking for a Lead Software Engineer who combines deep technical expertise with strong ownership and l ...
📑 Job SummarySynechron is seeking a skilled Java Fullstack Developer to design, develop, and maintain scalable, high-performance web applications. This role involves working across the entire software development lifecycle, enabling seamless integration between front-end and back-end components. T ...
📑 Working with Us Challenging. Meaningful. Life-changing. Those aren’t words that are usually associated with a job. But working at Bristol Myers Squibb is anything but usual. Here, uniquely interesting work happens every day, in every department. From optimizing a production line to the latest brea ...
📑 Company overview( Accordion | The Leader in Private Equity Consulting | Office of the CFO )Accordion is a global financial consulting and technology firm helping CFOs and their teams drive value creation. Rooted in private equity rigor and powered by data, analytics, and AI, we partner with c ...
📑 Working with UsChallenging. Meaningful. Life-changing. Those aren’t words that are usually associated with a job. But working at Bristol Myers Squibb is anything but usual. Here, uniquely interesting work happens every day, in every department. From optimizing a production line to the latest break ...
📑 Assistant Professor - CSE Immediate joiner will be given preference Graduation - B.Tech/B.E. (CSE/IT/AI )Post-Graduation - M.Tech/M.E./M.S. (CSE/IT/Software Systems) any other computer sc ...
📑 About Pollax Pollax builds AI voice and text systems for customer support. We train and deploy speech and language models that power customer interactions for businesses. Role We are hiring a Machine Learning Intern to work with our ML team on training, fine-tuning, and deploying the models in our production sta ...
📑 We're Hiring: Group Marketing Manager (B2 B Industrial) Noida | Full-Time | Reports to CEO/MD The Company The company is India's leading provider of safe, productive, and high-quality Industrial solutions. With a manufacturing heritage tracing back to 1930, the Group has evolved int ...
📑 Lead RTL Design Engineer (ASIC) Location: Chennai, Tamil Nadu Experience: 6 to 9 Years Job Description 6 to 9 Years of experience in Synthesis, Constrain ...
📑 Assistant Professor - CSE Immediate joiner will be given preference Graduation - B.Tech/B.E. (CSE/IT/AI )Post-Graduation - M.Tech/M.E./M.S. (CSE/IT/Software Systems) any other computer sc ...
📑 JOB DETAILS Hyperledger Fabric Developer Minimum 6 years of IT experience, at least 2 years in Blockchain development projects This is a Remote position but we prefer the candidate to be in East coast Mid west area Excellent communication, presentation and client ha ...
📑 Responsibilities Monitor, investigate, and resolve production issues to ensure optimal availability and performance of eCommerce platforms. Perform deep troubleshooting using log analysis, APM tools, RUM, browser developer tools, and local testing. Author and maintain ...
📑 Description & Summary: A career within….Responsibilities: 1. Required years of experience : 3-5 years 2. Engage in design, development and deployment of data integration solutions employing a three-tiered ETL methodology. 3. Utilize Python and Py-Spark to extract data from diver ...
📑 Rockstar is recruiting for a fast-growing, profitable company that is blending humans and AI to build a new infrastructure for employability. This client is focused on empowering employers to recruit talent at a fraction of the traditional cost, unlocking more opportunities for everyone. The company has achie ...
📑 Java FSD - CREQ Description JAVA FSD Job Summary We are looking for a talented and motivated Senior Full Stack Developer to join our team. In this role, you will be involved in building dynamic and scalable web applications using and Spring Boot. Responsibilities Develop user ...
📑 Your job: Develop and test high-quality application software for automation technologies Develop software applications for commissioning, parameterisation, and programming of servo drives, PLCs, and remote I/Os. Implement, integrate, test, and deploy software following DevOps prin ...
📑 Hiring for a next-generation technology company building sovereign, secure, and scalable digital platforms across AI, Web3.0, cloud, and health-tech. Lead the design and implementation of a modern analytics platform using 100% open-source technologies. Build scalable data pipelines, l ...
📑 Assistant Professor - CSE Immediate joiner will be given preference Graduation- B.Tech/B.E. (CSE/IT/AI )Post-Graduation- M.Tech/M.E./M.S. (CSE/IT/Software Systems) any other computer science fiel dPh.D. in any Computer Scienc ...
📑 Lead RTL Design Engineer (ASIC) Location: Chennai, Tamil Nadu Experience: 6 to 9 Years Job Description 6 to 9 Years of experience in Synthesis, Constrain ...
📑 Role: AI/ML Engineer Location: Noida/ BLR/ Pune We are hiring AI/ML Engineers for Product based company in Insurance domain to build accelerators, data products, and AI-infused tools. This is an opportunity to build cutting-edge AI solutions that tr ...
📑 Job Description: 1. Typical Day: Power Platform Development: Design and develop Canvas and Model-driven Power Apps for enterprise use cases Build and maintain Power Automate flows for workflow automation Implement robust solutions using Dataverse, connectors, and APIs E ...
📑 Hybrid Opportunity-3 WFO + 2 WFH PF and Gratuity included About Our Client This opportunity is with a small-sized company operating in the Technology & Telecoms industry. The company is dedicated to providing exceptional services and solutions within the technology sec ...
📑 This role is for one of the Weekday's clients Min Experience: 7+ years Location: Bengaluru JobType: full-time Requirements 7+ years of experience in software development, including a minimum of 3 years of direct hands-on work with GoLang. ...
📑 ? Hiring: Firmware Development Engineers (PMFW / PSP / ABL / BMC Firmware) ? Location: Whitefield, Bangalore ? Employment Type: Full-Time ?? Experience: 4–12 Years We are hiring experienced Firmware Development Engineers for multiple high-pri ...
📑 Company Description A3CEND is a specialist employee and enterprise development company — combining people, data, and intelligent technology to make capability building personalised, scalable, and measurable. Role Description As the Founding Tech Lead at A3 ...
📑 We are seeking a proactive QA Engineer to ensure the quality and integrity of our software ecosystems. You will be responsible for the full testing lifecycle, from analyzing requirements and identifying edge cases to maintaining and expanding automated test suites for web and API platform ...
📑 About Us CCTech's mission is to transform human life by the democratization of technology. We are a well established digital transformation company building the applications in the areas of CAD, CFD, Artificial Intelligence, Machine Learning, 3D Webapps, Augmented ...
📑 Lead RTL Design Engineer (ASIC) Location: Chennai, Tamil Nadu Experience: 6 to 9 Years Job Description 6 to 9 Years of experience in Synthesis, Constrain ...
📑 At OneSpan, we specialize in digital identity and anti-fraud solutions that create exceptional and secure experiences. We are a global leader in providing high-assurance identity verification, transaction signing, authentication, mobile security, simplified e-signature workflows, and secure video colla ...
📑 Hiring for a next-generation technology company building sovereign, secure, and scalable digital platforms across AI, Web3.0, cloud, and health-tech. Lead the design and implementation of a modern analytics platform using 100% open-source technologies. Build scalable data pipelines, l ...
📑 Role: AI/ML Engineer Location: Noida/ BLR/ Pune We are hiring AI/ML Engineers for Product based company in Insurance domain to build accelerators, data products, and AI-infused tools. This is an opportunity to build cutting-edge AI solutions that tr ...
📑 Company Description A3CEND is a specialist employee and enterprise development company — combining people, data, and intelligent technology to make capability building personalised, scalable, and measurable. Role Description As the Founding Tech Lead at A3 ...
📑 Assistant Professor - CSE Immediate joiner will be given preference Graduation - B.Tech/B.E. (CSE/IT/AI )Post-Graduation - M.Tech/M.E./M.S. (CSE/IT/Software Systems) any other computer sc ...
📑 Role: AI/ML Engineer Location: Noida/ BLR/ Pune We are hiring AI/ML Engineers for Product based company in Insurance domain to build accelerators, data products, and AI-infused tools. This is an opportunity to build cutting-edge AI solutions that transform insurance op ...
📑 Company Description A3CEND is a specialist employee and enterprise development company — combining people, data, and intelligent technology to make capability building personalised, scalable, and measurable. Role Description As the Founding Tech Lead at A3CEND, you will be re ...
📑 Company Description A3CEND is a specialist employee and enterprise development company — combining people, data, and intelligent technology to make capability building personalised, scalable, and measurable.Role Description As the Founding Tech Lead at A3CEN ...
📑 Assistant Professor - CSEImmediate joiner will be given preferenceGraduation- B.Tech/B.E. (CSE/IT/AI)Post-Graduation- M.Tech/M.E./M.S. (CSE/IT/Software Systems) any other computer science fi ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,467,184+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Purchasing / Import / Export... | Good People HR Pty Ltd | Full time,Part time |
| Architect, AI Data Platform & Engineering | Rubrik | Full-time |
| Lead Consultant - AI Application Engineering | AstraZeneca | Full-time |
| Quality Platform Lead | Branch International | Full-time |
| Software Engineering Senior Analyst | HIH Cigna Health Solutions India Private Limited – HIH | Full-time |
| Senior Member Of Technical Staff- Backend | Athenahealth | Full-time |
| Lead Software Engineer | Morningstar | Full-time |
| Assistant Architect-Blockchain... | Allianz Technology SE India Branch | Full-time |
| Fullstack Java Developer | React &... | Synechron | Full-time |
| Software Engineering Senior Analyst | HIH Cigna Health Solutions India Private Limited – HIH | Full time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!