📑 About Xook At Xook, we are building a new food distribution model powered by a fleet of fully cloud-controlled robots. We believe in a future where every person can have freshly made food tailored to their personalized taste using digital recipes, Io T, and robotics. As an engineer joining u ...
📑 ABOUT TRICOG Tricog is a healthcare technology, product-based company headquartered in Bangalore. We build predictive and virtual diagnostic solutions for cardiovascular diseases, enabling clinicians to make faster, more accurate decisions that save lives. Our software directly ...
📑 ABOUT TRICOGTricog is a healthcare technology, product-based company headquartered in Bangalore. We build predictive and virtual diagnostic solutions for cardiovascular diseases, enabling clinicians to make faster, more accurate decisions that save lives.Our software directly supports cli ...
📑 ABOUT TRICOG Tricog is a healthcare technology, product-based company headquartered in Bangalore. We build predictive and virtual diagnostic solutions for cardiovascular diseases, enabling clinicians to make faster, more accurate decisions that save lives. Our software directly supports ...
📑 ABOUT TRICOGTricog is a healthcare technology, product-based company headquartered in Bangalore. We build predictive and virtual diagnostic solutions for cardiovascular diseases, enabling clinicians to make faster, more accurate decisions that save lives.Our software directly su ...
📑 About XookAt Xook, we are building a new food distribution model powered by a fleet of fully cloud-controlled robots. We believe in a future where every person can have freshly made food tailored to their personalized taste using digital recipes, IoT, and robotics.As an engineer joining us during our glo ...
📑 About XookAt Xook, we are building a new food distribution model powered by a fleet of fully cloud-controlled robots. We believe in a future where every person can have freshly made food tailored to their personalized taste using digital recipes, IoT, and robotics.As an engineer joining us during our glo ...
📑 ABOUT TRICOGTricog is a healthcare technology, product-based company headquartered in Bangalore. We build predictive and virtual diagnostic solutions for cardiovascular diseases, enabling clinicians to make faster, more accurate decisions that save lives.Our software directly su ...
📑 Candidate Profiles- Radware API security We look for Product Engineers rather than just Coders. For a hybrid, cross functional squad in the Cyber/API Security space, the profile needs to emphasize ownership and architectural empathy. Expert Software Engineer (Cyber & API Security) The ...
📑 ABOUT TRICOG Tricog is a healthcare technology, product-based company headquartered in Bangalore. We build predictive and virtual diagnostic solutions for cardiovascular diseases, enabling clinicians to make faster, more accurate decisions that save lives. Our software directly supports ...
📑 ABOUT TRICOG Tricog is a healthcare technology, product-based company headquartered in Bangalore. We build predictive and virtual diagnostic solutions for cardiovascular diseases, enabling clinicians to make faster, more accurate decisions that save lives. Our software directly supports ...
📑 ABOUT TRICOG Tricog is a healthcare technology, product-based company headquartered in Bangalore. We build predictive and virtual diagnostic solutions for cardiovascular diseases, enabling clinicians to make faster, more accurate decisions that save lives. Our software directly ...
📑 Location: Pune, India Help us build the future of digital at Hershey ! We’re looking for a Senior Software Development Engineer to join our growing engineering team in Pune. This is a unique opportunity to be part of a new organization from the ground up - shaping ...
📑 About Xook At Xook, we are building a new food distribution model powered by a fleet of fully cloud-controlled robots. We believe in a future where every person can have freshly made food tailored to their personalized taste using digital recipes, Io T, and robotics. As an engineer joining u ...
📑 ABOUT TRICOG Tricog is a healthcare technology, product-based company headquartered in Bangalore. We build predictive and virtual diagnostic solutions for cardiovascular diseases, enabling clinicians to make faster, more accurate decisions that save lives. Our software directly ...
📑 we are looking for a Data Scientist as we support our partner in developing a Global Analytics Unit —a global, centralized team with the ambition to strengthen data-driven decision-making and the development of smart data products for day-to-day operations. The team is designed to foster a data ...
📑 Senior Java Full Stack engineerLet’s be unstoppable together!At Circana, we are fueled by our passion for continuous learning and growth, we seek and share feedback freely, and we celebrate victories both big and small in an environment that is flexible and accommodating to ...
📑 Project Role : Technology Support EngineerProject Role Description : Resolve incidents and problems across multiple business system components and ensure operational stability. Create and implement Requests for Change (RFC) and update knowledge base articles to support effective troubleshoot ...
📑 Who we are VOIS (Vodafone Intelligent Solutions) is a strategic arm of Vodafone Group Plc, creating value for customers by delivering intelligent solutions through Talent, Technology & Transformation.As the largest shared services organisation in the global telco industry with ...
📑 Job DescriptionSenior Software Engineer (Java Full stack)PuneAbout the JobWe are seeking a highly skilled Senior Full Stack Developer with strong expertise in Java and Angular to join our dynamic team.The ideal candidate ...
📑 Senior Developer - CREQ193597 Description Development, re-factoring, extending and providing L3 support for Abinitio ETL Oracle-file batch services. 5+ years of Abinitio ETL technology stack 3+ years of Oracle query design/refactor/optimization. Localization: India Pune/Chennai Duration: long ...
📑 Senior Developer - CREQ Description Development, re-factoring, extending and providing L3 support for Abinitio ETL Oracle-file batch services. 5+ years of Abinitio ETL technology stack 3+ years of Oracle query design/refactor/optimization. Localization: India Pune/Chennai Duration: long term ...
📑 Key Responsibilities:Design, configure, and integrate AUTOSAR Basic Software (BSW) modules for automotive ECU platforms.Work experience in ETAS Stack is MandatoryWork on Com Stack components (Network Management, Communication Manager, PDU Router, CAN, ...
📑 Technical Program Manager (TPM) Experience: 8–10 Years We are looking for a Technical Program Manager with strong expertise in AWS and/or Azure, Microsoft technology stack, Open Source technologies, and AI/ML solutions. Key Responsibilities • Manage end-to-end delivery of Cloud, .NET, AI, App Modernization, and ...
📑 Greetings from SigiloTech ! Apply only if you are form Kolkata. Are you a passionate problem-solver with a knack for coding? Whether you’re a fresher or have experience, if you hold a B.Sc or M.Sc in a relevant field, we’re looking for YOU! APPLY ONLY IF YOU A ...
📑 Greetings from SigiloTech ! Apply only if you are form Kolkata. Are you a passionate problem-solver with a knack for coding? Whether you’re a fresher or have experience, if you hold a B.Sc or M.Sc in a relevant field, we’re looking for YOU! AP ...
📑 Greetings from SigiloTech ! Apply only if you are form Kolkata. Are you a passionate problem-solver with a knack for coding? Whether you’re a fresher or have experience, if you hold a B.Sc or M.Sc in a relevant field, we’re looking for YOU! APPLY ONLY IF YOU ARE FROM B.Sc/M. ...
📑 Greetings from SigiloTech ! Apply only if you are form Kolkata. Are you a passionate problem-solver with a knack for coding? Whether you’re a fresher or have experience, if you hold a B.Sc or M.Sc in a relevant field, we’re looking for YOU! APPLY ONLY IF YOU ARE FROM B.Sc/M. ...
📑 SAP FICO Functional Consultant Location: Mumbai Employment Type: Full-Time Experience: 6–8 Years About the Role We are looking for an experienced SAP FICO Functional Consultant to manage and support Finance & Controlling pro ...
📑 Greetings from SigiloTech ! Apply only if you are form Kolkata. Are you a passionate problem-solver with a knack for coding? Whether you’re a fresher or have experience, if you hold a B.Sc or M.Sc in a relevant field, we’re looking for YOU! APPLY ONLY IF YOU ARE FROM B.Sc/M. ...
📑 Greetings from SigiloTech ! Apply only if you are form Kolkata. Are you a passionate problem-solver with a knack for coding? Whether you’re a fresher or have experience, if you hold a B.Sc or M.Sc in a relevant field, we’re looking for YOU! APPLY ONLY IF YOU ...
📑 SAP FICO Functional ConsultantLocation: MumbaiEmployment Type: Full-TimeExperience: 6–8 YearsAbout the RoleWe are looking for an experienced SAP FICO Functional Consultant to ma ...
📑 Company DescriptionWho is Turner & Townsend?All over the world people are using buildings, infrastructure, and assets we helped to deliver. It could be the hospital they work in, the railway they travel on every day, the fuel that powers their car or the dat ...
📑 Explore your next opportunity at a Fortune Global 500 organization. Envision innovative possibilities, experience our rewarding culture, and work with talented teams that help you become better every day. We know what it takes to lead UPS into tomorrow—people with a unique combination of skill + passion. ...
📑 Dated: June 4, 2025 Chitkara University is looking for Assistant and Associate Professors for Department of Computer Science and Engineering. Education Qualification- Graduation- B.Tech/B.E. (CSE/IT) Post-Graduation- M.Tech/M.E./M.S. (CSE/IT/Software Systems) any other computer sc ...
📑 Job Summary: JECRC College, Jaipur invites applications for the position of Professor (Computer Science) from accomplished academicians with expertise in Artificial Intelligence (AI), Data Science, Machine Learning, Cybersecurity, and emerging technologies, along with strong teaching, research, and a ...
📑 Job Summary:JECRC College, Jaipur invites applications for the position of Professor (Computer Science) from accomplished academicians with expertise in Artificial Intelligence (AI), Data Science, Machine Learning, Cybersecurity, and emerging technologies , along with strong teaching, research, and academ ...
📑 Description: The Chevron ENGINE - Senior Site reliability Engineer - Automation for Network Product Line. The Senior Site reliability Engineer - Automation is responsible for consulting, developing, deploying and supporting network applications, software tools, automation and solutions for the Network ...
📑 Description: The Chevron ENGINE - Senior Site reliability Engineer - Automation for Network Product Line. The Senior Site reliability Engineer - Automation is responsible for consulting, developing, deploying and supporting network applications, software tools, automation and solutions for the Network ...
📑 DescriptionJoin us in building the future of personal devices at Amazon! Are you ready to shape the future of how people experience technology in their everyday lives? Join us in building the next generation of personal devices — where hardware, software, and AI converge to create experiences that f ...
📑 ABOUT EVERNORTH:Evernorth℠ exists to elevate health for all, because we believe health is the starting point for human potential and progress. As champions for affordable, predictable and simple health care,we solve the problems others don’t, won’t or can’t.Our innovation hub in India will allow us t ...
📑 Come help Amazon create and deploy advanced technologies to deliver packages to the customer's doorstep!Our team is seeking a Sr. Software Development Engineer to help build the core backend services that power our driver delivery mobile app. The ideal candidate is a full-stack engineer whose primary strength is ...
📑 ABOUT EVERNORTH:Evernorth℠ exists to elevate health for all, because we believe health is the starting point for human potential and progress. As champions for affordable, predictable and simple health care,we solve the problems others don't, won't or can't.Our innovation hub in India will allow us t ...
📑 The RoleWe are looking for an experienced and proficient full-stack software engineer with over 10 years of experience, who is passionate about solving business problems in the banking and financial domain through innovation and engineering practices. This role will be responsible for writing co ...
📑 Come help Amazon create and deploy advanced technologies to deliver packages to the customer's doorstep! Our team is seeking a Sr. Software Development Engineer to help build the core backend services that power our driver delivery mobile app. The ideal candidate is a full-stack engineer whose primary ...
📑 We are seeking a motivated and detail-oriented CA Industrial trainee to join our team. This role will provide hands-on experience in accounting, financial operations, and compliance, enabling you to apply your theoretical knowledge in a practical setting.Key Responsibilities: - A ...
📑 This role is for one of the Weekday's clientsSalary range: Rs 3500000 - Rs 5000000 (ie INR 35 - 50 LPA)Min Experience: 10 yearsLocation: MumbaiJobType: full-timeThis senior, high-impact position is tailored for a pragmatic, sea ...
📑 The opportunity We’re looking for Senior with expertise in full-stack application development using .NET, C# for Agentic AI applications to join the TTT team in the Tax Service Line. This is a fantastic opportunity to be part of a pioneering firm while playing ...
📑 We are seeking a motivated and detail-oriented CA Industrial trainee to join our team. This role will provide hands-on experience in accounting, financial operations, and compliance, enabling you to apply your theoretical knowledge in a practical setting. Key Responsibilities: - A ...
📑 Job Description Job Type: Full time Work Experience: 3-5 years Location: Ahmedabad We are seeking a skilled Senior Full Stack Developer with strong hands-on experience in Angular (frontend) and Java/Spring Boot (backend). ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,697,681+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Senior electronic design engineer | Xook | Full-time |
| Senior Fullstack Engineer - (MERN) | Tricog Health | Full-time |
| Senior Fullstack Engineer - (MERN) | Tricog Health | Full-time |
| Senior Fullstack Engineer - (MERN) | Tricog Health | Full-time |
| Integrated Systems Engineer | Tricog Health | Full-time |
| Senior Electronic Design Engineer | Xook | Full-time |
| Senior Electronic Design Engineer | Xook | Full-time |
| Senior Fullstack Engineer - | Tricog Health | Full-time |
| Principal Software Engineer | Radware | Full-time |
| Senior Fullstack Engineer - (MERN) | Tricog Health | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!