📑 About XookAt Xook, we are building a new food distribution model powered by a fleet of fully cloud-controlled robots. We believe in a future where every person can have freshly made food tailored to their personalized taste using digital recipes, IoT, and robotics.As an engineer joining u ...
📑 Job DescriptionAbout the opportunity We are hiring on behalf of a well-established global IT consulting and implementation firm with offices across North America, Europe, and India (HITEC City, Hyderabad). The organisation delivers technology solutions across C ...
📑 About XookAt Xook, we are building a new food distribution model powered by a fleet of fully cloud-controlled robots. We believe in a future where every person can have freshly made food tailored to their personalized taste using digital recipes, IoT, and robotics.As an engineer ...
📑 About Xook At Xook, we are building a new food distribution model powered by a fleet of fully cloud-controlled robots. We believe in a future where every person can have freshly made food tailored to their personalized taste using digital recipes, IoT, and robotics. As an engin ...
📑 Overview: TekWissen is a global workforce management provider throughout India and many other countries in the world. The below client is a global company with shared ideals and a deep sense of family. From our earliest days as a pioneer of modern transportation, we h ...
📑 About Xook At Xook, we are building a new food distribution model powered by a fleet of fully cloud-controlled robots. We believe in a future where every person can have freshly made food tailored to their personalized taste using digital recipes, IoT, and robotics. As an engin ...
📑 We are building a high-performing engineering team that harnesses the power of Claude AI and Agentic Code, and we need a technical leader who thrives equally in architecture reviews and in the weeds of a pull request. This is a rare opportunity to define how an ambitious, AI-native engineering culture is buil ...
📑 About Xook At Xook, we are building a new food distribution model powered by a fleet of fully cloud-controlled robots. We believe in a future where every person can have freshly made food tailored to their personalized taste using digital recipes, IoT, and robotics. As an engin ...
📑 Job Description About the opportunity We are hiring on behalf of a well-established global IT consulting and implementation firm with offices across North America, Europe, and India (HITEC City, Hyderabad). The organisation delivers technology solutions across Cloud, DevOps, SAP, and A ...
📑 We are building a high-performing engineering team that harnesses the power of Claude AI and Agentic Code, and we need a technical leader who thrives equally in architecture reviews and in the weeds of a pull request. This is a rare opportunity to define how an ambitious, AI-native engineering culture is buil ...
📑 About Xook At Xook, we are building a new food distribution model powered by a fleet of fully cloud-controlled robots. We believe in a future where every person can have freshly made food tailored to their personalized taste using digital recipes, IoT, and robotics. As an engin ...
📑 About Xook At Xook, we are building a new food distribution model powered by a fleet of fully cloud-controlled robots. We believe in a future where every person can have freshly made food tailored to their personalized taste using digital recipes, IoT, and robotics. As an engineer joinin ...
📑 About Xook At Xook, we are building a new food distribution model powered by a fleet of fully cloud-controlled robots. We believe in a future where every person can have freshly made food tailored to their personalized taste using digital recipes, IoT, and robotics. As an engineer joinin ...
📑 We are building a high-performing engineering team that harnesses the power of Claude AI and Agentic Code, and we need a technical leader who thrives equally in architecture reviews and in the weeds of a pull request. This is a rare opportunity to define how an ambitious, AI-native engineering culture is buil ...
📑 𝗙𝘂𝗹𝗹𝘀𝘁𝗮𝗰𝗸 𝗘𝗻𝗴𝗶𝗻𝗲𝗲𝗿 — 𝗔𝗜 𝗮𝗻𝗱 𝗜𝗻𝗱𝘂𝘀𝘁𝗿𝗶𝗮𝗹 𝗔𝘂𝘁𝗼𝗺𝗮𝘁𝗶𝗼𝗻Full-time | Bangalore (In-office) | 2-4 yearsSalary 8-10 LPA Attention!!! Only those willing to Relocate to Bangalore should apply.In-Short we are seeking a ...
📑 𝗙𝘂𝗹𝗹𝘀𝘁𝗮𝗰𝗸 𝗘𝗻𝗴𝗶𝗻𝗲𝗲𝗿 — 𝗔𝗜 𝗮𝗻𝗱 𝗜𝗻𝗱𝘂𝘀𝘁𝗿𝗶𝗮𝗹 𝗔𝘂𝘁𝗼𝗺𝗮𝘁𝗶𝗼𝗻Full-time | Bangalore (In-office) | 2-4 yearsSalary 8-10 LPA Attention!!! Only those willing to Relocate to Bangalore should apply.In-Short we are seeking a ...
📑 About Position: We are looking for a hands-on Lead AI Engineer to build and scale real-world Generative AI solutions. The role involves working with LLMs, RAG pipelines, and end-to-end system ownership, driving AI product development from design to production. Role: AI Engineer Location: Bengaluru Experience: 6 ...
📑 Job DescriptionAbout the Team:The Bluetooth R&D team at Silicon Labs develops and maintains Bluetooth protocol stack software supporting Bluetooth Classic and Bluetooth Low Energy (BLE). The team delivers scalable, standards-compliant Bluetooth solutions used across ...
📑 Job DescriptionAbout the Team:The Bluetooth R&D team at Silicon Labs develops and maintains Bluetooth protocol stack software supporting Bluetooth Classic and Bluetooth Low Energy (BLE). The team delivers scalable, standards-compliant Bluetooth solutions used across ...
📑 Job Purpose: We are looking for a talented and experienced Senior Engineering Manager with a strong technical background, particularly in Golang or Java. The ideal candidate will be a proficient coder capable of mentoring a team to deliver high-quality code. The role involves managing ...
📑 Job Purpose: We are looking for a talented and experienced Senior Engineering Manager with a strong technical background, particularly in Golang or Java. The ideal candidate will be a proficient coder capable of mentoring a team to deliver high-quality code. The role involves managing ...
📑 Job Purpose: We are looking for a talented and experienced Senior Engineering Manager with a strong technical background, particularly in Golang or Java. The ideal candidate will be a proficient coder capable of mentoring a team to deliver high-quality code. The role involves managing ...
📑 Job Purpose: We are looking for a talented and experienced Senior Engineering Manager with a strong technical background, particularly in Golang or Java. The ideal candidate will be a proficient coder capable of mentoring a team to deliver high-quality code. The role involves managing ...
📑 **Key Responsibilities:** + Design and Development of Client Connectivity platform to establish best in Class Client connectivity solutions across the globe.+ Development of low latency solutions on Java stack and HFT Framework. ( Use technical skills to ensure busine ...
📑 **Key Responsibilities:** + Design and Development of Client Connectivity platform to establish best in Class Client connectivity solutions across the globe.+ Development of low latency solutions on Java stack and HFT Framework. ( Use technical skills to ensure busine ...
📑 **Who You'll Work With** You'll join the Nike Marketing Technology platforms team focused on building next-generation Digital Asset Management (DAM) systems powering Nike's global marketing ecosystem. The team partners closely with product, content ops, and engineering teams to enable scalable, AI-drive ...
📑 **Who You'll Work With** You'll join the Nike Marketing Technology platforms team focused on building next-generation Digital Asset Management (DAM) systems powering Nike's global marketing ecosystem. The team partners closely with product, content ops, and engineering teams to enable scalable, AI-drive ...
📑 Technical Program Manager (TPM)Experience: 8–10 YearsWe are looking for a Technical Program Manager with strong expertise in AWS and/or Azure, Microsoft technology stack, Open Source technologies, and AI/ML solutions.Key Responsibilities• Manage end-to-end delivery of Cloud, .NET, ...
📑 Technical Program Manager (TPM) Experience: 8–10 Years We are looking for a Technical Program Manager with strong expertise in AWS and/or Azure, Microsoft technology stack, Open Source technologies, and AI/ML solutions. Key Responsibilities • Manage end-to-end delivery of Cloud, .N ...
📑 Technical Program Manager (TPM)Experience: 8–10 YearsWe are looking for a Technical Program Manager with strong expertise in AWS and/or Azure, Microsoft technology stack, Open Source technologies, and AI/ML solutions.Key Responsibilities• Manage end-to-end delivery of Cloud, .NET, ...
📑 Technical Program Manager (TPM) Experience: 8–10 Years We are looking for a Technical Program Manager with strong expertise in AWS and/or Azure, Microsoft technology stack, Open Source technologies, and AI/ML solutions. Key Responsibilities • Manage end-to-end delivery of Cloud, .N ...
📑 Job DescriptionDevOps EngineerRole OverviewThe DevOps Engineer will be responsible for building, automating, and operating modern application delivery platforms across VMware-based datacenter infrastructure, Azure ...
📑 Job DescriptionDevOps EngineerRole OverviewThe DevOps Engineer will be responsible for building, automating, and operating modern application delivery platforms across VMware-based datacenter infrastructure, Azure ...
📑 Technical Program Manager (TPM) Experience: 8–10 Years We are looking for a Technical Program Manager with strong expertise in AWS and/or Azure, Microsoft technology stack, Open Source technologies, and AI/ML solutions. Key Responsibilities • Manage end-to-end delivery of Cloud, .N ...
📑 Roles and Responsibilities Lead SME responsible for front end design and development of applications using MERN/ MEAN stack. Will be the go-to for any dev issues for guidance, resolutions by the dev team Review application architecture stack, architecture and design Develop standards, pra ...
📑 Technical Program Manager (TPM) Experience: 8–10 Years We are looking for a Technical Program Manager with strong expertise in AWS and/or Azure, Microsoft technology stack, Open Source technologies, and AI/ML solutions. Key Responsibilities • Manage end-to-end delivery of Cloud, .N ...
📑 Scope of Role- The DVA Engineer is responsible for Dimensional Variation Analysis and Tolerance stack up for ongoing and new projects. Knowledge / Experience: 2+ Years Area of Responsibility: ·DVA Engineer creates and maintains analysis models representin ...
📑 Roles and Responsibilities Lead SME responsible for front end design and development of applications using MERN/ MEAN stack. Will be the go-to for any dev issues for guidance, resolutions by the dev team Review application architecture stack, architecture and design Develop standards, pr ...
📑 Job Description DevOps Engineer Role Overview The DevOps Engineer will be responsible for building, automating, and operating modern application delivery platforms across VMware-based datacenter infrastructure, Azure Local (Azure Stack HCI), and Azu ...
📑 Technical Program Manager (TPM) Experience: 8–10 Years We are looking for a Technical Program Manager with strong expertise in AWS and/or Azure, Microsoft technology stack, Open Source technologies, and AI/ML solutions. Key Responsibilities • Manage end-to-end delivery of Cloud, .N ...
📑 Technical Program Manager (TPM) Experience: 8–10 Years We are looking for a Technical Program Manager with strong expertise in AWS and/or Azure, Microsoft technology stack, Open Source technologies, and AI/ML solutions. Key Responsibilities • Manage end-to-end delivery of Cloud, .N ...
📑 Seeking a Specialist with 5 to 7 years of experience in automation within FullStack Engineering focused on System Integration and DeploymentJob DescriptionDesign develop and implement automated solutions to streamline system integration and deployment processes Collaborate with crossfunctional teams to e ...
📑 RTL FPGA Design EngineerExperience: 2 to 4 YearsLocation: Hyderabad, India.Job Description:- Minimum of 2 years of RTL design and development experience, preferably in a customer facing role- Minimum of 2 years of experience in FPGA Verilog design, technology, and tools- Experience in dev ...
📑 Assistant Professor - CSEImmediate joiner will be given preferenceGraduation - B.Tech/B.E. (CSE/IT/AI)Post-Graduation - M.Tech/M.E./M.S. (CSE/IT/Software Systems) any other computer science fieldPh. D. in any Computer Science Fiel dArtificial Intelligence & Machine Learning, Inter ...
📑 Role: AI/ML EngineerLocation: Noida/ BLR/ PuneWe are hiring AI/ML Engineers for Product based company in Insurance domain to build accelerators, data products, and AI-infused tools. This is an opportunity to build cutting-edge AI solutions that transform insurance operations- from underwriting automation ...
📑 We are looking for an experiencedTechnology Manager (Delivery Leader)to drive large-scale programs, lead high-performing teams, and partner with global stakeholders to deliver impactful technology solutions.Must Have12+ years of experience with 3+ years in delivery/tech leadersh ...
📑 Hiring: Manager/ Senior Manager – Digital Marketing | Vega Industries Pvt. Ltd.We are looking for a highly technical and performance-driven digital marketing leader to own and scale our digital growth engine.: Manager/Senior Manager – Digital Marketing: 10+ Years: Sector 136, Noida<br/ ...
📑 Lead RTL Design Engineer (ASIC)Location: Chennai, Tamil NaduExperience: 6 to 9 YearsJob Description6 to 9 Years of experience in Synthesis, Constraints and interface timing Challenges. Good knowledge of Power is preferable.Strong Domain Knowledge on RTL Design, impleme ...
📑 About the Role This is not a traditional Sales Engineering role. You are a builder who sits at the intersection of engineering and revenue—the person who turns a prospect’s “can it do this?” into a live, working experience they can touch. You will own the technical narrative across the deal cycle by writing code ...
📑 Rivvun AI is looking for a hands-on AI Developer to design, build, and deploy the next generation of intelligent applications from the ground up. We aren't just plugging into APIs— we are building a scalable, secure, and reusable enterprise AI platform. Key Responsibili ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,786,973+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Senior Electronic Design Engineer | Xook | Full-time |
| Site Reliability Engineer (SRE) /... | N Human Resources & Management Systems | Full-time |
| Advanced PCB Design Specialist | Xook | Full-time |
| Senior Electronic Design Engineer | Xook | Full-time |
| Software Engineer (I) - Established... | Tekwissen India | Full-time |
| Senior Electronic Design Engineer | Xook | Full-time |
| Director-Technical Delivery | Simplify Healthcare | Full-time |
| Senior Electronic Design Engineer | Xook | Full-time |
| Site Reliability Engineer (SRE) /... | N Human Resources & Management Systems | Full-time |
| Director-Technical Delivery | Simplify Healthcare | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!