1,337,965+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

Quantitative Developer

📑 Position Overview We are looking for a Quantitative Developer to build and optimize high-performance trading systems with a focus on trade execution, order management systems (OMS), and low-latency infrastructure. You will work closely with traders, quants, and infrastructure teams t ...

Ai agent builder marketing

📑 Role Overview:As our Marketing AI Agent Builder, you will be the lead architect for our agentic marketing stack. Your goal is to move beyond simple automation (if-this-then-that) toward autonomous systems that reason through marketing data, execute multi-channel campaigns, and self-correct based on perfo ...

Ai agent builder marketing

📑 Role Overview:As our Marketing AI Agent Builder, you will be the lead architect for our agentic marketing stack. Your goal is to move beyond simple automation (if-this-then-that) toward autonomous systems that reason through marketing data, execute multi-channel campaigns, and self-correct based on perfo ...

Ai agent builder marketing

📑 Role Overview:As our Marketing AI Agent Builder, you will be the lead architect for our agentic marketing stack. Your goal is to move beyond simple automation (if-this-then-that) toward autonomous systems that reason through marketing data, execute multi-channel campaigns, and self-correct based on perfo ...

Vehicle Integration Expert NOVUS

📑 Job Title : Vehicle Integration Expert Function : VIDA Department : Emerging Mobility Business Unit Job Purpose Statement : You will lead the end-to-end mechanical integration of all emerging mobility in ...

Solutions Architect Microservices and Data

📑 About Us CoffeeBeans Consulting is a tech consulting firm focused on making organizations AI-ready by structuring their data efficiently across various sources and enabling AI-driven solutions. We specialize in data architecture, pipelines, governance, MLOps, and Gen AI solutions, helping clients achieve faster ...

Forklift Operator

📑 Job Description Job Summary: The Forklift Operator is responsible for safely operating forklifts to move, load, unload, stack, and transport raw materials, finished goods, yarn, fabric rolls, packing materials, and other materials within the textile manufacturing facility. The op ...

Mobile Software Engineer

📑 Job Description Role Overview: We are looking for a specialized Mobile Application Developer to lead the development of our patient-facing mobile experience on both iOS and Android. This app serves as the primary touchpoint for pregnant and postpartum moms, integrating remote physiologic mo ...

Vehicle Integration Expert NOVUS

📑 Job Title: Vehicle Integration ExpertFunction: VIDADepartment: Emerging Mobility Business UnitJob Purpose Statement:You will lead the end-to-end mechanical integration of all emerging mobility in NOVUS p ...

Backend Engineer (Node.js & TypeScript) | SDE 1 Mumbai

📑 Hiring for: An emerging general insurance business in India. AI-led, fast and transparent.Role: Backend Engineer (Node.js & TypeScript) | SDE-1Experience: 1 to 3 YearsLocation(s): Mumbai - Work from office (Vikhroli)Type: On-site / PermanentNotice Period: Immedia ...

Vehicle Integration Expert NOVUS

📑 Job Title: Vehicle Integration ExpertFunction: VIDADepartment: Emerging Mobility Business UnitJob Purpose Statement:You will lead the end-to-end mechanical integration of all emerging mobility in NOVUS p ...

Backend Engineer (Ruby on Rails / TypeScript / Python)

📑 I’m Hiring a Backend Engineer (Top 10% Only) Location: Bangalore (On-site) Experience: 2–6 YearsI run ClearStack. We build serious, scalable systems for global clients. We move fast. We ship often. We fix what breaks. No politics. No passenger ...

Backend Engineer (Ruby On Rails / Typescript / Python)

📑 I’m Hiring a Backend Engineer (Top 10% Only) Location: Bangalore (On-site) Experience: 2–6 YearsI run ClearStack. We build serious, scalable systems for global clients. We move fast. We ship often. We fix what breaks. No politics. No passenge ...

Backend Engineer (Ruby on Rails / TypeScript / Python)

📑 I’m Hiring a Backend Engineer (Top 10% Only) Location: Bangalore (On-site) Experience: 2–6 YearsI run ClearStack. We build serious, scalable systems for global clients. We move fast. We ship often. We fix what breaks. No politics. No passeng ...

Backend Engineer (Ruby on Rails / TypeScript / Python)

📑 I’m Hiring a Backend Engineer (Top 10% Only) Location: Bangalore (On-site) Experience: 2–6 YearsI run ClearStack. We build serious, scalable systems for global clients. We move fast. We ship often. We fix what breaks. No politics. No passengers. Our primary stac ...

Vehicle Integration Expert NOVUS

📑 Job Title: Vehicle Integration ExpertFunction: VIDADepartment: Emerging Mobility Business UnitJob Purpose Statement:You will lead the end-to-end mechanical integration of all emerging mobility in NOVUS p ...

Backend Engineer (Ruby on Rails / TypeScript / Python)

📑 I’m Hiring a Backend Engineer (Top 10% Only) Location: Bangalore (On-site) Experience: 2–6 YearsI run ClearStack. We build serious, scalable systems for global clients. We move fast. We ship often. We fix what breaks. No politics. No passengers. Our primary stac ...

SAP Tax Engine Manager/Senior

📑 - Exp Required: 5 - 12 Years- Locations: BLR, CHN, PUN, HYD, NCR, Kolkata, KERALA, COIMBATORE- Tech Stack: SAP S/4HANA + Vertex (O Series/Accelerators) OR ONESOURCE (GlobalNext)- Domain: Indirect Taxation (VAT, Sales & Use Tax, GST) embedded into OTC & PTP flows.- Process: Fast-tracked 2-round in ...

Vehicle Integration Expert NOVUS

📑 Job Title: Vehicle Integration ExpertFunction: VIDADepartment: Emerging Mobility Business UnitJob Purpose Statement:You will lead the end-to-end mechanical integration of all emerging mobility in NOVUS ...

Backend Engineer (Node.js & TypeScript) | SDE 1 Mumbai

📑 Hiring for:An emerging general insurance business in India. AI-led, fast and transparent.Role:Backend Engineer (Node.js & TypeScript) | SDE-1Experience:1 to 3 YearsLocation(s):Mumbai - Work from office (Vikhroli)Type:On-site / PermanentNotice ...

Vehicle Integration Expert NOVUS

📑 Job Title : Vehicle Integration Expert Function : VIDA Department : Emerging Mobility Business Unit Job Purpose Statement : You will lead the end-to-end mechanical integration of all emerging mobility in NOVUS platforms. In this role, you will ...

API & Database Architect

📑 I’m Hiring a Backend Engineer (Top 10% Only) Location: Bangalore (On-site) Experience: 2–6 YearsI run ClearStack. We build serious, scalable systems for global clients. We move fast. We ship often. We fix what breaks. No politics. No passenge ...

Backend Engineer (Ruby on Rails / TypeScript / Python)

📑 I’m Hiring a Backend Engineer (Top 10% Only) Location: Bangalore (On-site) Experience: 2–6 YearsI run ClearStack. We build serious, scalable systems for global clients. We move fast. We ship often. We fix what breaks. No politics. No passenger ...

Scalable Systems Backend Engineer

📑 I’m Hiring a Backend Engineer (Top 10% Only) Location: Bangalore (On-site) Experience: 2–6 YearsI run ClearStack. We build serious, scalable systems for global clients. We move fast. We ship often. We fix what breaks. No politics. No passenge ...

Magento 2 Frontend Developer (Hyvä Experience Required)

📑 About the Role We are looking for a skilled Magento 2 Frontend Developer with strong experience in Hyvä theme development. The ideal candidate should have hands-on experience in migrating from Magento Luma/Blank themes to Hyvä and building high-performance, modern storefronts.Key Responsibilities Develop and mai ...

SAP Tax Engine Manager/Senior

📑 - Exp Required: 5 - 12 Years- Locations: BLR, CHN, PUN, HYD, NCR, Kolkata, KERALA, COIMBATORE- Tech Stack: SAP S/4HANA + Vertex (O Series/Accelerators) OR ONESOURCE (GlobalNext)- Domain: Indirect Taxation (VAT, Sales & Use Tax, GST) embedded into OTC & PTP flows.- Process: Fast-tracked 2-round in ...

Vehicle Integration Expert NOVUS

📑 Job Title: Vehicle Integration ExpertFunction: VIDADepartment: Emerging Mobility Business UnitJob Purpose Statement:You will lead the end-to-end mechanical integration of all emerging mobility in NOVUS platforms. In this role, you will manage ...

Backend Engineer (Ruby on Rails / TypeScript / Python)

📑 I’m Hiring a Backend Engineer (Top 10% Only) Location : Bangalore (On-site) Experience : 2–6 Years I run ClearStack. We build serious, scalable systems for global clients. We move fast. We ship often. We fix what breaks. No politics. No passengers. Our primary ...

Software Engineer

📑 We use our expertise and products to craft customer experiences. Our range of services helps global brand acquire, engage and retain choice-rich customers.© 2023 Collinson International Limited. Registered in England & Wales under registration No. 2577557Registered address : 3 More London Riverside ...

Associate Marketing Director

📑 About the Company Razorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for Indian b ...

Founder’s office AI Enablement

📑 About Signeasy Contracts run businesses. We are unlocking the intelligence inside them. Signeasy began fifteen years ago with a simple idea: document signing should be effortless. That idea helped the world go paperless. Today, more than 48,000 businesses worldwide trust Signeasy, and o ...

Associate Marketing Director

📑 About the CompanyRazorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for Indian bus ...

Associate Marketing Director

📑 About the Company Razorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for In ...

Associate Marketing Director

📑 About the Company Razorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for Indian b ...

Associate Marketing Director

📑 About the Company Razorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for Indian businesses ...

Associate Marketing Director

📑 About the Company Razorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for Indian businesses ...

Associate Marketing Director

📑 About the CompanyRazorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for Indian ...

Associate Marketing Director

📑 About the Company Razorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for Indian businesses ...

Associate Marketing Director

📑 About the CompanyRazorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for Indian businesses - ...

Senior Marketing Program Manager

📑 About the CompanyRazorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for Indian ...

Data Engineer L5

📑 ANSR is hiring for one of its clients. About American Airlines: To Care for People on Life's Journey®. Together with our American Eagle regional partners, we offer thousands of flights daily to more than 350 destinations in more than 60 countries. American Airlines is transforming the way it delivers technology ...

Associate Marketing Director

📑 About the CompanyRazorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for Indian businesses - ...

Associate Marketing Director

📑 About the Company Razorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for Indian businesses ...

Associate Marketing Director

📑 About the CompanyRazorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for Indian ...

Associate Marketing Director

📑 About the CompanyRazorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for Indian bus ...

Growth Marketing Lead

📑 About the CompanyRazorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for Indian ...

Associate Director of Marketing Strategy

📑 About the CompanyRazorpay is one of India’s leading full-stack financial technology companies, powering the way businesses move, manage, and grow money. Founded in 2014 by Harshil Mathur and Shashank Kumar with a simple vision - to simplify payments for Indian ...

Drupal developer

📑 Job Title Drupal Developer Location (s) Cochin/TVM Years of Experience 3-5 YEARS Job Description We are seeking a Senior Drupal Developer with 4+ years of experience to lead the development, customization, and maintenance of complex Drupal-based applications. This role requires a ...

Senior iOS Engineer (Swift, AVFoundation & Mobile Capture)

📑 About UsGramian Consultancy is a boutique consultancy specializing in IT professional services and engineering talent solutions. With a strong background in software engineering and leadership, we help companies build high-performing teams by matching them with professionals who truly ...

Production AI Specialist (Real time Speech & Language)

📑 AI Engineer — Voice & Languag5+ Years · Full-Time· Jaipur ·Competitive SalaryAbout the RoleWe're hiring a senior AI Engineer to design, build, and ship production AI systems — with strong emphasis on Voice AI. You'll own the full lifecycle: a ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,337,965+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
Quantitative Developer Delta Exchange Full-time
Ai agent builder - marketing Trantor Full-time
Ai agent builder - marketing Trantor Full-time
Ai agent builder - marketing Trantor Full-time
Vehicle Integration Expert- NOVUS Hero MotoCorp Full-time
Solutions Architect Microservices and Data CoffeeBeans Full-time
Forklift Operator ASPIRE TEXTILES LLP Full-time
Mobile Software Engineer NAVINYAA SOLUTIONS Full-time
Vehicle Integration Expert- NOVUS Hero MotoCorp Full-time
Backend Engineer (Node.js &... datavruti Full-time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!