📑 Nitor Infotech Inc. has openings for Technical Architect in Schaumburg, IL: Job Title: Technical Architect Job Duration: 40 Hours / Week, Permanent position, Full time Job Duties: Define and design architecture aligned with business requirements and techno ...
📑 Our CompanyChanging the world through digital experiences is what Adobe’s all about. We give everyone—from emerging artists to global brands—everything they need to design and deliver exceptional digital experiences! We’re passionate about empowering people to create beautiful and powerful im ...
📑 JOB DETAILS 1.Have overall experience of 10+ years as technical architect in one of the following stack: Microsoft .NET / Azure / Java / AWS and at least 5+ years as technical architect in Salesforce.com space.2.Must have worked with multi org environments for at least 2+ years.<b ...
📑 Role: Nodejs_+React Developer Location: BangaloreExperience: 5+ Years Key Responsibilities: Develop and maintain scalable web applications using React.js</strong ...
📑 Description :Job Profile:Key Responsibilities:Responsible for design and development of real time embedded software/firmware and PC/mobile based software application.To Analyse domain specific technical or low level requirement and modification as per ...
📑 Description :Job Profile:Key Responsibilities:Responsible for design and development of real time embedded software/firmware and PC/mobile based software application.To Analyse domain specific technical or low level requirement and modification as per ...
📑 Design, develop, and maintain full-stack web applications using modern frameworks and technologies.Collaborate with cross-functional teams to gather requirements and translate them into technical specifications.Build responsive and accessible user ...
📑 Job Description? Hiring: Firmware Development Engineers (PMFW / PSP / ABL / BMC Firmware)? Location: Whitefield, Bangalore? Employment Type: Full-Time</di ...
📑 Job Description? Hiring: Firmware Development Engineers (PMFW / PSP / ABL / BMC Firmware)? Location: Whitefield, Bangalore? Employment Type: Full-Time</di ...
📑 Description :Job Profile:Key Responsibilities:Responsible for design and development of real time embedded software/firmware and PC/mobile based software application.To Analyse domain specific technical or low level requirement and modification as per ...
📑 JOB DETAILS 1.Have overall experience of 10+ years as technical architect in one of the following stack: Microsoft .NET / Azure / Java / AWS and at least 5+ years as technical architect in Salesforce.com space.2.Must have worked with multi org environments for at least 2+ years.<b ...
📑 Job DescriptionDesign, develop, and maintain full-stack web applications using modern frameworks and technologies.Collaborate with cross-functional teams to gather requirements and translate them into technical specifications.Build resp ...
📑 Description :Job Profile:Key Responsibilities:Responsible for design and development of real time embedded software/firmware and PC/mobile based software application.To Analyse domain specific technical or low level requirement and modification as per ...
📑 TECHNICAL TEAM LEADER Job Description: To be responsible for the overall direction, coordination, implementation, execution, control and completion of specific projects ensuring consistency with company strategy, commitments a ...
📑 Be part of a team that designs, develops and integrates highly complex software functions within Honeywell Connected Industrial. You will use your experience and judgment to plan and accomplish goals. You will also generate innovative solutions in work situations; trying different and novel ways to deal with ...
📑 Job Title: Java FSD Experience: 6-9yrs / 3-6yrsLocation: Bangalore /GurgaonEmployment Type: Full-Time/hybrid Key skills- Core Java ,Microservices ,springbbot, Angular, SQL Job R ...
📑 The Applications Development Senior Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute to app ...
📑 The Applications Development Senior Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute to app ...
📑 IND Staff Engineer, Infrastructure - GCC036We’re determined to make a difference and are proud to be an insurance company that goes well beyond coverages and policies. Working here means having every opportunity to achieve your goals – and to help others accomplish theirs, too. Join our team as we help shape ...
📑 Job Summary: We are seeking an experienced Senior .NET Developer with a strong background in designing and building scalable software solutions, particularly in enterprise-level applications. This role involves leading development efforts, architecting robust RESTful APIs, wo ...
📑 CodelogicX is a pioneering technology company, proudly certified with ISO 9001:2015 and ISO/IEC 27001:2013 standards. Recognized as the SaaS Company of the Year, we are committed to advancing innovation and delivering state-of-the-art solutions that redefine industry standards. We are looking for a highl ...
📑 What we want: Vertoz is looking for a seasoned Lead Java Developer to join our engineering team in Mumbai. In this role, you will balance high-level technical strategy with hands-on execution. You will be responsible for architecting scalable systems, mentoring a talented team ...
📑 Job Description – Talent Acquisition Specialist / Senior Talent Acquisition Specialist Company: AlgoTale Location: BangaloreExperience: 6+ YearsEmployment Type: Full-TimeJoining: </str ...
📑 Position Description: Position DescriptionCompany Profile:Founded in , CGI is among the largest independent IT and business consulting services firms in the world. With 94, consultants and professionals across the globe, CGI delivers an end-to-end portfolio of capabilities, f ...
📑 Amazon Time & Pay Innovation (T&PA) organisation is looking for Senior Software Development Engineers who enjoy working in a green field environment building large-scale intelligent products and services that offer a consumer grade user experience using a service oriented architecture, based on native AWS compon ...
📑 Location: Bengaluru, India Company: Pibit.ai Experience: 5+ Years Employment Type: Full-Time Pibit.ai is an SF-based insurtec ...
📑 Optum is a global organization that delivers care, aided by technology to help millions of people live healthier lives. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benefits, data and resources they need to feel their best. Here, you will fin ...
📑 Amazon Time & Pay Innovation (T&PA) organisation is looking for Software Development Engineers who enjoy working in a green field environment building large-scale intelligent products and services that offer a consumer grade user experience using a service oriented architecture, based on native AWS components.<b ...
📑 Amazon Time & Pay Innovation (T&PA) organisation is looking for Software Development Engineers who enjoy working in a green field environment building large-scale intelligent products and services that offer a consumer grade user experience using a service oriented architecture, based on native AWS components.<b ...
📑 Have you ever wanted to be part of a team that builds highly efficient operating system for E-reader? Amazon's E-reader team owns full stack device platform, Productivity offering built on GenAI, LLM, handwriting recognition etc and low-level components that make the device energy efficient with weeks of battery ...
📑 Job Title: US Healthcare Technical Recruiter (Contract) Location: Hyderabad (WFO) Shift: US Shift (Night Shift) Experience: 3–8 Years Employment Type: 6 Month Contract to Hire Job Summary We ...
📑 Job Description Job Title: US Healthcare Technical Recruiter (Contract) Location: Hyderabad (WFO) Shift: US Shift (Night Shift) Experience: 3–8 Years Employment Type: 6 Month Contract to Hire J ...
📑 The Applications Development Senior Programmer Analyst is an intermediate level position responsible for participation in the establishment and implementation of new or revised application systems and programs in coordination with the Technology team. The overall objective of this role is to contribute to app ...
📑 Retention & CRM SpecialistWho are WeWe are Go Stops - Go STOPS threw open its doors in 2014 based on the simple belief that travel changes lives. When you go MORE, you be MORE: be it at the start of the journey when you’re braving your first solo train ride; in the middle, when you’ve found a kindred spi ...
📑 About Jobizo Jobizo is India's leading healthcare staffing platform connecting healthcare providers and professionals across the country. We are scaling rapidly across India and international markets and are looking for a senior marketing leader to own and grow our digital presence. About th ...
📑 Senior Salesforce Pre-Sales Solution Engineer Location: Hyderabad | Bengaluru | Chennai | Mumbai | Pune Experience: 6 years total, minimum 1 year in Pre-Sales Solution Engineering Employment Type: Full-Time About Wilco Source Wilco Source is a Salesforce partner exclusively focused on Healthcare & Life Sciences ...
📑 ---**About ALIV**ALIV is a doctor-led regenerative wellness clinic offering targeted IV therapies, PRP/PRFM, peptides, and autologous cell-based therapies. We work at the intersection of prevention, performance, and longevity — with a focus on ethical care and measurable outcomes. We're expanding across ...
📑 Company Vision :Stock Gro is an investment advisory and knowledge platform that connects users with SEBI-registered experts to explore advanced investment strategies. It empowers users to master trading and investing through insightful market analysis, expert recommendations, and AI-powered research tools. W ...
📑 We are looking for an experienced Technical Lead to own and drive the full softwaredevelopment lifecycle for Provider Passport — a modern, microservices-based platform builton Spring Boot, Angular, AWS, and Firebase. You will be the technical decision-makerresponsible for architecture, code quality, ...
📑 About Position: We are seeking a Gen AI Architect to lead the design and implementation of enterprise-scale Generative AI and agentic AI solutions on the Microsoft Azure platform. This role focuses on defining end-to-end AI architecture, enabling intelligent agent ecosystems, and driving scalable, secure, and re ...
📑 ---**About ALIV**ALIV is a doctor-led regenerative wellness clinic offering targeted IV therapies, PRP/PRFM, peptides, and autologous cell-based therapies. We work at the intersection of prevention, performance, and longevity — with a focus on ethical care and measurable outcomes. We're expan ...
📑 Company Vision :Stock Gro is an investment advisory and knowledge platform that connects users with SEBI-registered experts to explore advanced investment strategies. It empowers users to master trading and investing through insightful market analysis, expert recommendations, and AI-powered research tools. W ...
📑 Company Vision :StockGro is an investment advisory and knowledge platform that connects users with SEBI-registered experts to explore advanced investment strategies. It empowers users to master trading and investing through insightful market analysis, expert recommendations, and AI-powered research too ...
📑 Retention & CRM SpecialistWho are WeWe are Go Stops - Go STOPS threw open its doors in 2014 based on the simple belief that travel changes lives. When you go MORE, you be MORE: be it at the start of the journey when you’re braving your first solo train ride; in the middle, when you’ve found a kindred spi ...
📑 ---**About ALIV**ALIV is a doctor-led regenerative wellness clinic offering targeted IV therapies, PRP/PRFM, peptides, and autologous cell-based therapies. We work at the intersection of prevention, performance, and longevity — with a focus on ethical care and measurable outcomes. We're expanding across ...
📑 We are looking for an experienced Technical Lead to own and drive the full softwaredevelopment lifecycle for Provider Passport — a modern, microservices-based platform builton Spring Boot, Angular, AWS, and Firebase. You will be the technical decision-makerresponsible for architecture, code quality, ...
📑 We are looking for an experienced Technical Lead to own and drive the full softwaredevelopment lifecycle for Provider Passport — a modern, microservices-based platform builton Spring Boot, Angular, AWS, and Firebase. You will be the technical decision-makerresponsible for architecture, code quality, ...
📑 About JobizoJobizo is India's leading healthcare staffing platform connecting healthcare providers and professionals across the country. We are scaling rapidly across India and international markets and are looking for a senior marketing leader to own and grow our digital presence.About the RoleWe ar ...
📑 About Jobizo Jobizo is India's leading healthcare staffing platform connecting healthcare providers and professionals across the country. We are scaling rapidly across India and international markets and are looking for a senior marketing leader to own and grow our digital presence. About th ...
📑 Amazon Time & Pay Innovation (T&PA) organisation is looking for Software Development Engineers who enjoy working in a green field environment building large-scale intelligent products and services that offer a consumer grade user experience using a service oriented architecture, based on native AWS components.<b ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,421,547+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Engineering Manager | Nitor Infotech | Full-time |
| Computer Scientist 2 - Java, Kotlin & Android | Adobe | Full time |
| Salesforce Architect-Reputed IT... | Seven Consultancy | Full-time |
| Statusneo: Nodejs+React | Nexthire | Full Time |
| Automotive Linux BSP Senior Engineer | eInfochips Private Limited | Full time |
| Automotive Linux BSP Senior Engineer | eInfochips Private Limited | Full time |
| Require a Fullstack Engineer in Bangalore | TestHiring | Full-time |
| Firmware Development Engineers | Vrinda International | Full-time |
| Firmware Development Engineers | Vrinda International | Full-time |
| Automotive Linux BSP Senior Engineer | eInfochips Private Limited | Full time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!