📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 Position: Senior Developer – RightAngle Integration with C#, .NET, SQL Server, Experience: 7–10 years Location: Noida or Chennai, must work overlapping with USA time zone Technology Stack: C#, .NET Framewor ...
📑 Position: Senior Developer – RightAngle Integration with C#, .NET, SQL Server, Experience: 7–10 years Location: Noida or Chennai, must work overlapping with USA time zone Technology Stack: C#, .NET Framewor ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 Position: Senior Developer – RightAngle Integration with C#, .NET, SQL Server, Experience: 7–10 years Location: Noida or Chennai, must work overlapping with USA time zone Technology Stack: C#, .NET Framewor ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 Job Description: Linux Kernel Driver Developer Experience: 5 – 8 Years Location: Bangalore Role Overview We are looking for an experienced Linux Kernel Driver Developer with strong expertise in kernel internals, device driver development, and low-level system debugging. The candidate should have hands-on experie ...
📑 Job Description: Roles and resposibilities: Experience in installation and configuration of the Hyperion suite (11.1.2.x and 11.2.x) on both Linux and Windows environments. Proven experience in migration and upgrade of Hyperion application environments. Expertise in setting up disaster recovery for the Hyperion ...
📑 Lead Verification Engineer Experience: 7 years Location: Hyderabad Job Description: Work as a member of a geographically distributed verification team to verify next-generation ASIC and FPGAs Develop testplans, implement testbenches, create testcases, and ensure functional coverage closure Handle regression test ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 Formal Verification Engineer Experience : 4 to 12 Years Location : Bangalore Job Description Responsible for developing and executing formal verification strategies for IP and ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 Position: Senior Developer – RightAngle Integration with C#, .NET, SQL Server, Experience: 7–10 years Location: Noida or Chennai, must work overlapping with USA time zone Technology Stack: C#, .NET Framewor ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 Position: Senior Developer – RightAngle Integration with C#, .NET, SQL Server, Experience: 7–10 years Location: Noida or Chennai, must work overlapping with USA time zone Technology Stack: C#, .NET Framewor ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 Position: Senior Developer – RightAngle Integration with C#, .NET, SQL Server, Experience: 7–10 years Location: Noida or Chennai, must work overlapping with USA time zone Technology Stack: C#, .NET Framewor ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 Position: Senior Developer – RightAngle Integration with C#, .NET, SQL Server, Experience: 7–10 years Location: Noida or Chennai, must work overlapping with USA time zone Technology Stack: C#, .NET Framewor ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 Role : Senior Data Scientist Experience : 3 to 5 years. About the role : You’ll work on the core ranking and retrieval systems behind search, optimizing how user queries map to the product catalog at scale. ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won't just file tickets for engineers and wait — you'll write the code yourself. You'll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 SOC RTL Design Verification Experience : 4 to 10 Years Location : Bangalore Key Responsibilities: • Verification of SOC RTL (This is a DV Req) : FW-HW co-verificat ...
📑 Role : Senior Data Scientist Experience : 3 to 5 years. About the role : You’ll work on the core ranking and retrieval systems behind search, optimizing how user queries map to the product catalog at scale. ...
📑 Formal Verification Engineer Experience : 4 to 12 Years Location : Bangalore Job Description Responsible for developing and executing formal verification strategies for IP and ...
📑 Job Title: Associate Vice President Experience: 17 years Location: Hyderabad/ Greater Noida We at Coforge are hiring Enterprise Solution Architect with the following skillset: Architecture & Solutioning Contribute to architecture guiding principles, IT standards, and enterprise roadmaps. Define enterprise and so ...
📑 JOB DETAILS Application Support of point of sale application across all Retail Outlets - Perform POS rollout at new Outlets- Monitor & manage databases.Perform root cause analysis- Be part of the new projects related to point of sale- Understand POS technology stack for any kin ...
📑 Job Profile- Title- Technical Solution Analyst( Support Domain) Location- Bangalore (Hybrid) Exp- 8 years JD- Roles and Responsibilities: Enable digital transformation of support systems by aligning business, operations and technology Evaluate industry technology landscape, discover tech stack, design solutions ...
📑 Details on tech stack Technical Skills: Strong proficiency in Next.js (Latest, preferable Next 14 and above) and React.js. Have very good exposure on front end architectures. Have a strong Micro Front End experience Proficient in JavaScript, TypeScript, HTML5, CSS3 and Tailwind CSS. Experience with server-side r ...
📑 Role : Senior Data Scientist Experience : 3 to 5 years. About the role : You’ll work on the core ranking and retrieval systems behind search, optimizing how user queries map to the product catalog at scale. What you’ll do: <p ...
📑 Role : Senior Data Scientist Experience : 3 to 5 years. About the role : You’ll work on the core ranking and retrieval systems behind search, optimizing how user queries map to the product catalog at scale. What you’ll do: <p ...
📑 JOB DETAILS Application Support of point of sale application across all Retail Outlets - Perform POS rollout at new Outlets- Monitor & manage databases.Perform root cause analysis- Be part of the new projects related to point of sale- Understand POS technology stack for any kin ...
📑 Candidate should have: • Experience designing, developing, and testing applications using proven or emerging technologies, in a variety of technologies and environments. • Experience in using and tuning relational databases (Azure SQL Datawarehouse and SQL DB, MS SQL Server, or other RDBMS is a ...
📑 Job Description Collaborates with Business Analysts, Product managers and Tech Lead to implement the solution. Designs and implements efficient solutions that meet the functional requirements. Extends existing or develops new code base using proven best-practice patte ...
📑 The RoleThis is a hybrid role for someone who lives at the intersection of SEO and software engineering . You won‘t just file tickets for engineers and wait — you‘ll write the code yourself. You‘ll own technical SEO end to end, build the internal tooling that makes our SEO operation scale, an ...
📑 Job Title: Senior PCB Layout Engineer (Allegro)Location: Chennai / Bangalore (as applicable)Experience: 8–12 YearsJob DescriptionWe are looking for an experienced PCB Layout Engineer with strong expertise in Allegro tools to join our hardware design team. The ideal candidate will have hands-on ex ...
📑 Key responsibilities:- Support and monitor weekend batch loads, ensuring timely and accurate execution- Perform outlier detection and root cause analysis for issues such as demand forecast drops or anomalies- Translate findings into clear insights and communicate them effectively to leads and stakeho ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,107,838+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| SEO Engineering at US Startup [Need... | Swades AI | Full-time |
| SEO Engineering at US Startup [Need... | Swades AI | Full-time |
| SEO Engineering at US Startup [Need... | Swades AI | Full-time |
| SEO Engineering at US Startup [Need... | Swades AI | Full-time |
| SEO Engineering at US Startup [Need... | Swades AI | Full-time |
| SEO Engineering at US Startup [Need... | Swades AI | Full-time |
| Developer | HCLTech | Full-time |
| Developer | HCLTech | Full-time |
| SEO Engineering at US Startup [Need... | Swades AI | Full-time |
| Developer | HCLTech | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!