1,107,838+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

Machine learning engineer

📑 Key responsibilities:- Support and monitor weekend batch loads, ensuring timely and accurate execution- Perform outlier detection and root cause analysis for issues such as demand forecast drops or anomalies- Translate findings into clear insights and communicate them effectively to leads and stakeho ...

Enterprise Solutions Architect

📑 Job Title: Associate Vice President Experience: 17 years Location: Hyderabad/ Greater Noida We at Coforge are hiring Enterprise Solution Architect with the following skillset: Architecture & Solutioning Contribute to architecture guiding principles, IT standards, and enterprise roadmaps. Define enterprise and so ...

Technical Solution Analyst (Support Domain)

📑 Job Profile- Title- Technical Solution Analyst( Support Domain) Location- Bangalore (Hybrid) Exp- 8 years JD- Roles and Responsibilities: Enable digital transformation of support systems by aligning business, operations and technology Evaluate industry technology landscape, discover tech stack, design solutions ...

Senior Frontend Developer

📑 Details on tech stack Technical Skills: Strong proficiency in Next.js (Latest, preferable Next 14 and above) and React.js. Have very good exposure on front end architectures. Have a strong Micro Front End experience Proficient in JavaScript, TypeScript, HTML5, CSS3 and Tailwind CSS. Experience with server-side r ...

Hyperion Administrator

📑 Job Description: Roles and resposibilities: Experience in installation and configuration of the Hyperion suite (11.1.2.x and 11.2.x) on both Linux and Windows environments. Proven experience in migration and upgrade of Hyperion application environments. Expertise in setting up disaster recovery for the Hyperion ...

Verification Lead

📑 Lead Verification Engineer Experience: 7 years Location: Hyderabad Job Description: Work as a member of a geographically distributed verification team to verify next-generation ASIC and FPGAs Develop testplans, implement testbenches, create testcases, and ensure functional coverage closure Handle regression test ...

Linux Kernel Driver Developer

📑 Job Description: Linux Kernel Driver Developer Experience: 5 – 8 Years Location: Bangalore Role Overview We are looking for an experienced Linux Kernel Driver Developer with strong expertise in kernel internals, device driver development, and low-level system debugging. The candidate should have hands-on experie ...

Formal Verification Engineer

📑 Formal Verification Engineer Experience : 4 to 12 Years Location : Bangalore Job Description Responsible for developing and executing formal verification strategies for IP and ...

RTL Design Verification Engineer

📑 SOC RTL Design Verification Experience : 4 to 10 Years Location : Bangalore Key Responsibilities: • Verification of SOC RTL (This is a DV Req) : FW-HW co-verificat ...

Development Expert (Java/ Kotlin/ Go/ Dot Net), SAP Concur Travel

📑 **We help the world run better**At SAP, we keep it simple: you bring your best to us, and we'll bring out the best in you. We're builders touching over 20 industries and 80% of global commerce, and we need your unique talents to help shape what's next. The work is challenging – but it matters. You'll find a ...

Senior Enterprise Software Engineer

📑 At Medtronic you can begin a life-long career of exploration and innovation, while helping champion healthcare access and equity for all. You’ll lead with purpose, breaking down barriers to innovation in a more connected, compassionate world. **A Day in the Life**Full Stack Developer - GenAI/ONIT<br ...

principal Engineer Site Reliability Engineering and AIOps

📑 **About this role:** We are looking for a Principal Engineer to set the enterprise technical direction for Site Reliability Engineering and AIOps within Enterprise Functions Technology (EFT). This is a hands-on architecture and engineering leadership role responsible for defining the reliability strateg ...

Data Engineering Architect

📑 Role: Data Engineering Architect with GCP Location: Ashok Nagar, Bengaluru Work mode: 3 Days Work from Office, 2 Days -Work from Home Work type: Direct and Permanent role(You will under Direct Payroll) Major skills : D ...

Senior Engagement Manager

📑 Role: Senior Engagement Manager Experience Range: 12+ years Location: Mumbai/Bangalore (Hybrid) Responsibilities: End-to-End Delivery Management: Own the delivery lifecycle for AI/ML projects, ensuring adherence to Agile meth ...

Financial Operations Manager

📑 Role: Finance & Compliance ManagerLocation: MumbaiExperience: 5+ YearsAbout the Role: We are looking for a meticulous and proactive finance professional to oversee our end-to-end accounting operations. This is a unique op ...

Openshift Administrator

📑 Job Title - Openshift AdministratorLocation - Bangalore, White FieldWork Mode - Hybrid• Kubernetes/OpenShift (4.x) administration (Installation, Patching, migration, application on-boarding, SSL certificates deployment, configuring ingress controllers, integrating with load bal ...

O&M Incharge Electrical

📑 Candidate should have qualification of either diploma in EEE with 5-15 years (OR)BE/B.Tech (EEE) with min of 6 years and maximum of 13 years’ experience.Experience in the field of operation and maintenance of electrical equipment.Having a keen experience in O&M of Various capacity Tr ...

Forward Deployed Product Specialist (Voice & Conversational Ai)

📑 JOB DESCRIPTIONRole: Forward Deployed Engineer (Voice & Conversational AI) - Scale Voice & Conversational AI product suite across 0-1, 1-0, 10-100 journeys Department: Product ManagementReports To: Head ...

Forward Deployed Product Specialist (Voice & Conversational AI)

📑 JOB DESCRIPTION Role: Forward Deployed Engineer (Voice & Conversational AI) - Scale Voice & Conversational AI product suite across 0-1, 1-0, 10-100 journeys Department: Product Management Reports To: Head of Product Location: Guru ...

Product Deployment & Integration Specialist

📑 JOB DESCRIPTIONRole: Forward Deployed Engineer (Voice & Conversational AI) - Scale Voice & Conversational AI product suite across 0-1, 1-0, 10-100 journeys Department: Product ManagementReports To: Head ...

Forward Deployed Product Specialist (Voice & Conversational AI)

📑 JOB DESCRIPTION Role: Forward Deployed Engineer (Voice & Conversational AI) - Scale Voice & Conversational AI product suite across 0-1, 1-0, 10-100 journeys Department: Product Management Reports To: Head of Product Location: Guru ...

Head of AI Search & Organic Growth

📑 About the job Head of AI Search & Organic Growth Location: Gurgaon About PlanetSpark PlanetSpark is India’s leading platform for kids’ & grown ups communication skills — public speaking, creative writing, spoken English. Trusted by 1,00,000+ parents across 10+ ...

Forward Deployed Product Specialist (Voice & Conversational AI)

📑 JOB DESCRIPTIONRole: Forward Deployed Engineer (Voice & Conversational AI) - Scale Voice & Conversational AI product suite across 0-1, 1-0, 10-100 journeys Department: Product ManagementReports To: Head of ProductLocation: Gurugram. Gre ...

Technical Lead Data Engineering

📑 About the role We are building EIQ, a platform product that enterprises use, among other things, to make their data governed, secured, controlled, discoverable, curated, processed, and delivered — across every stage of the data lifecycle. We don't just move data, we operationalize th ...

Head of AI Search & Organic Growth

📑 About the job Head of AI Search & Organic Growth Location: Gurgaon About PlanetSpark PlanetSpark is India’s leading platform for kids’ & grown ups communication skills — public speaking, creative writing, spoken English. Trusted by 1,00,000+ parents across 10+ ...

Forward Deployed Product Specialist (Voice & Conversational AI)

📑 JOB DESCRIPTION Role: Forward Deployed Engineer (Voice & Conversational AI) - Scale Voice & Conversational AI product suite across 0-1, 1-0, 10-100 journeys Department: Product Management Reports To: Head of Product Location: Guru ...

AI Voice Product Specialist

📑 JOB DESCRIPTIONRole: Forward Deployed Engineer (Voice & Conversational AI) - Scale Voice & Conversational AI product suite across 0-1, 1-0, 10-100 journeys Department: Product ManagementReports To: Head ...

Head of AI Search & Organic Growth

📑 About the job Head of AI Search & Organic Growth Location: Gurgaon About PlanetSpark PlanetSpark is India’s leading platform for kids’ & grown ups communication skills — public speaking, creative writing, spoken English. Trusted by 1,00,000+ parents across 10+ ...

Generative AI SEO Strategist

📑 About the jobHead of AI Search & Organic GrowthLocation: GurgaonAbout PlanetSparkPlanetSpark is India’s leading platform for kids’ & grown ups communication skills — public speaking, creative writing, spoken English. Trusted by 1,00,000+ parents across 10+ ...

AI Search & Organic Growth Lead

📑 About the jobHead of AI Search & Organic GrowthLocation: GurgaonAbout PlanetSparkPlanetSpark is India’s leading platform for kids’ & grown ups communication skills — public speaking, creative writing, spoken English. Trusted by 1,00,000+ parents across 10+ ...

Head Of Ai Search & Organic Growth

📑 About the jobHead of AI Search & Organic GrowthLocation: GurgaonAbout PlanetSparkPlanetSpark is India’s leading platform for kids’ & grown ups communication skills — public speaking, creative writing, spoken English. Trusted by 1,00,000+ parents across 10+ ...

Technical Lead – Healthcare Platform [8 10 YoE]

📑 Greymatter Innovationz helps you stay digitally relevant across domains, technologies, and skillsets, every day. We are looking for Technical Lead – Healthcare Platform (8 - 10 YoE) Location: Remote/ Anywhere in Ind Duration: FTE We are looking for a Technical Lead to drive the next generation of our Healthcare ...

SAP Customer Experience Consultant

📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able to manage core use cases ...

Project Manager

📑 About QpiAI At QPiAI, we are leading the effort to discover optimal AI and Quantum systems in Life sciences, Healthcare, Transportation, Finance, Industrial, and Space technologies. QPiAI is building a full stack Enterprise Quantum Computers. QPiAI Quantum hardware team is responsible for desig ...

Design Intern – B2B Art Projects

📑 MeMeraki.com is India’s largest culture-tech platform for traditional arts and crafts, working with 500+ master artisans across 300+ art forms to take Indian heritage to global audiences. The platform works at the intersection of technology, cultural storytelling, and commerce to create sustainable livelihood ...

Machine Learning Solutions Architect

📑 Recruitment Drive: DelhiDate: 23rd & 24th MayPosition: AI Specialist (AI Engineer/Design Researcher)Experience: 2 to 25 Years.Hiring for Pune & Bengaluru Location</p ...

Applied AI Systems Engineer

📑 Recruitment Drive: DelhiDate: 23rd & 24th MayPosition: AI Specialist (AI Engineer/Design Researcher)Experience: 2 to 25 Years.Hiring for Pune & Bengaluru Location</p ...

AI Specialist (AI Engineer/Design Researcher)

📑 Recruitment Drive: Delhi Date: 23rd & 24th May Position: AI Specialist (AI Engineer/Design Researcher) Experience: 2 to 25 Years. Hiring for Pune & Bengaluru Location About Company You may ...

Chief Technology & Product Officer (CTPO)

📑 About Miror Miror is building India's largest 360° care network for women - supporting them through menstruation, perimenopause, menopause, and beyond. We bring together a thriving community of 75,000+ women, 100+ doctors across gynaecology, oncology, urology and sexual health, nutrition and me ...

Generative AI Engineer

📑 About CodewallaCodewalla is a New York–based product studio with engineering teams in India. Since 2005, we’ve built innovative products that scale. We work at the intersection of design, engineering, and AI developing systems shaped by real business needs and tested in the real world. Our team ...

Sales Development Representative/SDR

📑 About us Restroworks (formerly Posist) is a leading cloud-based restaurant technology platform that powers over 25,000 restaurants in 50+ countries. It allows enterprise restaurant operators to grow at scale, improve bottom-line efficiency, and deliver a consistent guest experience. ...

AI/ML Research & Development Specialist

📑 Recruitment Drive: DelhiDate: 23rd & 24th MayPosition: AI Specialist (AI Engineer/Design Researcher)Experience: 2 to 25 Years.Hiring for Pune & Bengaluru Location</p ...

Lead Data Engineer

📑 Roles and Responsibilities: Define the enterprise data engineering architecture and technology standards across DB2, SQL Server, IBM DataStage, IBM Workload Scheduler, Oracle GoldenGate, and AWS Lead the multi-year platform modernization roadmap — phased migration from legacy on-premises ...

Delivery manager

📑 JOB DESCRIPTION Req ID: 372602 We are currently seeking a Delivery manager to join our team in Remote, Karnātaka (IN-KA), India (IN).Job Duties: 1. Lead E2E data project delivery across the insurance data platform, managing full lifecycles from initiation and planning through execution, U ...

Engineering Manager

📑 Job Title Engineering Manager L2 Location (s) Kochi/Trivandrum Years of Experience 13-15 years Job Description Engineering Manager (Java + Cloud + Distributed Systems)Experience Level: 12-15 YearsLocation: [Cochin/TVM/Bangalore in office]Employment Type: Full-timeP ...

Engineering Manager

📑 Engineering ManagerLocation: India, PuneAbout the RoleThe Engineering Manager is the operational heartbeat of a specific Product Area (Platform, Growth, or Contracts). You are responsible for the delivery velocity, professional growth, and operational health of 1–2 development Pods.<p ...

Market Development Associate

📑 About us Restroworks (formerly Posist) is a leading cloud-based restaurant technology platform that powers over 25,000 restaurants in 50+ countries. It allows enterprise restaurant operators to grow at scale, improve bottom-line efficiency, and deliver a consistent guest e ...

Staff AI Engineer, Agentic Systems

📑 **Our company** At Teradata, we believe that people thrive when empowered with better information. Teradata Autonomous Knowledge Platform activates enterprise intelligence by unifying data, knowledge and business context to achieve tangible outcomes. With Teradata, organizations can provide agents with ...

Delivery manager

📑 JOB DESCRIPTION Req ID: We are currently seeking a Delivery manager to join our team in Remote, Karnātaka (IN-KA), India (IN). Job Duties: 1. Lead E2E data project delivery across the insurance data platform, managing full lifecycles from initiation and planning through execution, UAT ...

Vice President Workflow Automation Specialist

📑 Whether you’re at the start of your career or looking to discover your next adventure, your story begins here. At **Citi** , you’ll have the opportunity to expand your skills and make a difference at one of the world’s most global banks. We’re fully committed to supporting your growth and development from the ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,107,838+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
Machine learning engineer Grid Dynamics Full-time
Enterprise Solutions Architect Coforge Full-time
Technical Solution Analyst (Support Domain) MacroHire Full-time
Senior Frontend Developer Grid Dynamics Full-time
Hyperion Administrator InfoBeans Full-time
Verification Lead ACL Digital Full-time
Linux Kernel Driver Developer L&T Technology Services Full-time
Formal Verification Engineer ACL Digital Full-time
RTL Design Verification Engineer ACL Digital Full-time
Development Expert (Java/ Kotlin/... SAP Full-time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!