📑 Job Description: Roles and resposibilities: Experience in installation and configuration of the Hyperion suite (11.1.2.x and 11.2.x) on both Linux and Windows environments. Proven experience in migration and upgrade of Hyperion application environments. ...
📑 Lead Verification Engineer Experience: 7+ years Location: Hyderabad Job Description: Work as a member of a geographically distributed verification team to verify next-generati ...
📑 Job Title: Senior PCB Layout Engineer (Allegro) Location: Chennai / Bangalore (as applicable) Experience: 8–12 Years Job Description We are looking for an experienced PCB Layout Engineer with ...
📑 Job Title: Senior PCB Layout Engineer (Allegro) Location: Chennai / Bangalore (as applicable) Experience: 8–12 Years Job Description We are looking for an experienced PCB Layout Engineer with ...
📑 Details on tech stack Technical Skills: Strong proficiency in Next.js (Latest, preferable Next 14 and above) and React.js. Have very good exposure on front end architectures. Have a strong Micro Front End experi ...
📑 . SMTS-System Software Engineer -- Security LOCATION: GREATER BENGALURU AREA Company Description We are looking for exceptional talent and leadership to join Fast Growing Startup into Scalable Intelligence, the world’s first company ...
📑 . SMTS-System Software Engineer -- Security LOCATION: GREATER BENGALURU AREA Company Description We are looking for exceptional talent and leadership to join Fast Growing Startup into Scalable Intelligence, the world’s first company ...
📑 Job Description: Roles and resposibilities: Experience in installation and configuration of the Hyperion suite (11.1.2.x and 11.2.x) on both Linux and Windows environments. Proven experience in migration and upgrade of Hyperion application environments. ...
📑 Job Title: Senior PCB Layout Engineer (Allegro) Location: Chennai / Bangalore (as applicable) Experience: 8–12 Years Job Description We are looking for an experienced PCB Layout Engineer with ...
📑 Amity University is a highly research-oriented, Innovation-driven and Inter-disciplinary University accredited by the NAAC with grade 'A+' and ranked #22 by NIRF. It has over 35,000 students at its campus in Noida (Delhi NCR). The University is ranked amongst the top 3% of universities globally and ...
📑 Hybrid Cloud & Public Cloud Pre-Sales Consultant Location: Noida Experience: 3–12 Years Role Summary Support hybrid cloud pre-sales engagements by designing solutions across on-prem, private, and public ...
📑 Hiring Primavera L2 Support Engineer for Bangalore/Hyderabad . Wissen InfoTech Pvt Ltd , Established in 2000 in US, we have global offices in US, UK, Europe, Mexico, Middle East, and India, with best in class infrastructure and development facilities sprea ...
📑 We at Value momentum looking for Data Engineer/ Lead Data Bricks Data Engineer Looking for only Immediate joiners Role: Data Engineer/Lead Data Bricks Data Engineer Experience: 3 –12 Years Employment Type: Perm ...
📑 We are looking for a Azure Architect who has expereince in Azure Infrastructure , Application Management and Terraforms Experience : 9 - 14 yrs Shift : Rotational shifts inclusive of night shift and Rotational Week off Location: </s ...
📑 Primary Responsibilities Project customer requirements into BOM, drawings, specifications, DFMEA etc. Design and develop steering column products that adhere to industry best practices and as per customer requirements. <str ...
📑 Tech Stack: Azure Databricks, Data modelling, PySpark, SQL Mandatory Domin Expertise: Manufacturing, Quality Squad Skills: •TOGAF Certified or equivalent •Deep understanding of the Data architecture discipline, processes, concepts and analytics best practices •Data Solutions ...
📑 Hiring Primavera L2 Support Engineer for Bangalore/Hyderabad . Wissen InfoTech Pvt Ltd , Established in 2000 in US, we have global offices in US, UK, Europe, Mexico, Middle East, and India, with best in class infrastructure and development facilities sprea ...
📑 Job Title: Senior PCB Layout Engineer (Allegro) Location: Chennai / Bangalore (as applicable) Experience: 8–12 Years Job Description We are looking for an experienced PCB Layout Engineer with ...
📑 We are looking for a Azure Architect who has expereince in Azure Infrastructure , Application Management and Terraforms Experience : 9 - 14 yrs Shift : Rotational shifts inclusive of night shift and Rotational Week off Location: Chennai, Bangalore and P ...
📑 Job Description: Roles and resposibilities: Experience in installation and configuration of the Hyperion suite (11.1.2.x and 11.2.x) on both Linux and Windows environments. Proven experience in migration and upgrade of Hyperion application environments. Expertise ...
📑 Job Description: Roles and resposibilities: Experience in installation and configuration of the Hyperion suite (11.1.2.x and 11.2.x) on both Linux and Windows environments. Proven experience in migration and upgrade of Hyperion application environments. Expertise ...
📑 Details on tech stack Technical Skills: Strong proficiency in Next.js (Latest, preferable Next 14 and above) and React.js. Have very good exposure on front end architectures. Have a strong Micro Front End experience Proficient in Ja ...
📑 Tech Stack: Azure Databricks, Data modelling, PySpark, SQL Mandatory Domin Expertise: Manufacturing, Quality Squad Skills: •TOGAF Certified or equivalent •Deep understanding of the Data architecture discipline, processes, concepts and analytics best practices •Data Solutions ...
📑 We at Value momentum looking for Data Engineer/ Lead Data Bricks Data Engineer Looking for only Immediate joiners Role: Data Engineer/Lead Data Bricks Data Engineer Experience: 3 –12 Years Employment Type: Permanent Work Mode: W ...
📑 Hiring Primavera L2 Support Engineer for Bangalore/Hyderabad . Wissen InfoTech Pvt Ltd , Established in 2000 in US, we have global offices in US, UK, Europe, Mexico, Middle East, and India, with best in class infrastructure and development facilities spread across the globe. ...
📑 Hiring Primavera L2 Support Engineer for Bangalore/Hyderabad . Wissen InfoTech Pvt Ltd , Established in 2000 in US, we have global offices in US, UK, Europe, Mexico, Middle East, and India, with best in class infrastructure and development facilities spread across the globe. ...
📑 Primary Responsibilities Project customer requirements into BOM, drawings, specifications, DFMEA etc. Design and develop steering column products that adhere to industry best practices and as per customer requirements. Design the steering column prod ...
📑 Primary Responsibilities Project customer requirements into BOM, drawings, specifications, DFMEA etc. Design and develop steering column products that adhere to industry best practices and as per customer requirements. Design the steering column prod ...
📑 Hiring Primavera L2 Support Engineer for Bangalore/Hyderabad . Wissen InfoTech Pvt Ltd , Established in 2000 in US, we have global offices in US, UK, Europe, Mexico, Middle East, and India, with best in class infrastructure and development facilities sprea ...
📑 Primary Responsibilities Project customer requirements into BOM, drawings, specifications, DFMEA etc. Design and develop steering column products that adhere to industry best practices and as per customer requirements. <str ...
📑 Job Description: Roles and resposibilities: Experience in installation and configuration of the Hyperion suite (11.1.2.x and 11.2.x) on both Linux and Windows environments. Proven experience in migration and upgrade of Hyperion application environments. ...
📑 Automation & Control Engineer Role mission Own the motion intelligence layer — the kinematics, dynamics, and control code that turn perception into safe, precise physical action. This is the role closest to the hardware and the role on which deployment reliability ultimately rests. Key responsibilities Design mo ...
📑 AMS Circuit Design Engineer Experience : 2 to 8 Years. Location : Hyderabad. Notice Period : 30 to 60 days. B.Tech or M.Tech. in Electronics and Electrical Engineering from an institute of repute. 2 to 8 years of experience in Analog and SERDES IP Circuit Design. The candidate should have relevant experience in ...
📑 Exp Required: 5 - 12 Years Locations: BLR, CHN, PUN, HYD, NCR, Kolkata, KERALA, COIMBATORE Tech Stack: SAP S/4HANA Vertex (O Series/Accelerators) OR ONESOURCE (GlobalNext) Domain: Indirect Taxation (VAT, Sales & Use Tax, GST) embedded into OTC & PTP flows. Process: Fast-tracked 2-round interview process. Key Ro ...
📑 Experience : 10 years Location : Bengaluru, Karnataka Industry : Semi Conductor Working model : Hybrid Role Overview This role is responsible for technical leadership and execution of hardware development for the RH850 Motor Control and Automotive Application Platform. The Sr. Staff Engineer serves as a hardware ...
📑 NoC Verification Engineer Experience : 7 to 14 Years Key Responsibilities: Develop UVM-based verification environments for NoC/IP blocks such as FlexNoC, GNOC, or custom NoC fabrics. Define and implement test plans, coverage models, scoreboards, monitors, and checkers for coherent and non-coherent traffic. Integ ...
📑 Company Description Graviq.ai delivers smarter decisions through innovative artificial intelligence solutions. Focused on tackling complex industry challenges, we specialize in forecasting, optimization, and generative AI technologies. Our mission is to empower businesses with data-dr ...
📑 Details on tech stack Technical Skills: Strong proficiency in Next.js (Latest, preferable Next 14 and above) and React.js. Have very good exposure on front end architectures. Have a strong Micro Front End experi ...
📑 . SMTS-System Software Engineer -- Security LOCATION: GREATER BENGALURU AREA Company Description We are looking for exceptional talent and leadership to join Fast Growing Startup into Scalable Intelligence, the world’s first company ...
📑 . SMTS-System Software Engineer -- Security LOCATION: GREATER BENGALURU AREA Company Description We are looking for exceptional talent and leadership to join Fast Growing Startup into Scalable Intelligence, the world’s first company ...
📑 Lead Verification Engineer Experience: 7+ years Location: Hyderabad Job Description: Work as a member of a geographically distributed verification team to verify next-generati ...
📑 Primary Responsibilities Project customer requirements into BOM, drawings, specifications, DFMEA etc. Design and develop steering column products that adhere to industry best practices and as per customer requirements. <str ...
📑 Tech Stack: Azure Databricks, Data modelling, PySpark, SQL Mandatory Domin Expertise: Manufacturing, Quality Squad Skills: •TOGAF Certified or equivalent •Deep understanding of the Data architecture discipline, processes, concepts and analytics best practices •Data Solutions ...
📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...
📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...
📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...
📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...
📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...
📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...
📑 Knowledge of front-office operations over SAP Customer Experience suite, C/4HANA and interactions with Commerce, Sales, Marketing, Service cloud for Customer journey. -Understand what Customer Data Platforms capabilities and showcase to Client about benefit of available features. - Able ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,069,196+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Hyperion Administrator | InfoBeans | Full-time |
| Verification Lead | ACL Digital | Full-time |
| Senior Printed Circuit Board Designer | HCLTech | Full-time |
| Senior Printed Circuit Board Designer | HCLTech | Full-time |
| Senior Frontend Developer | Grid Dynamics | Full-time |
| SMTS-System Software Engineer -- Security | Tsavorite Scalable Intelligence | Full-time |
| SMTS-System Software Engineer -- Security | Tsavorite Scalable Intelligence | Full-time |
| Hyperion Administrator | InfoBeans | Full-time |
| Senior Printed Circuit Board Designer | HCLTech | Full-time |
| Assistant Professor- Computer... | Amity University | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!