📑 1. Position Summary The Data Engineering Lead is responsible for designing, building and operating data platforms and pipelines required for AI, analytics and automation use cases. The role leads a team of Data Engineers to implement the data architecture defined by the Architecture Lead and Solution A ...
📑 Location: Noida / Chennai / Bangalore / Pune Experience: 10+ years Position Overview We are looking for a dynamic and client-focused Data & AI Presales Solution Architect who brings deep presales expertise combined w ...
📑 Requisition Id: As a global leader in assurance, tax, transaction and advisory services, we hire and develop the most passionate people in their field to help build a better working world. This starts with a culture that believes in giving you the training, opportunities and creative freedom. At EY, ...
📑 Our Company: At Teradata, we believe that people thrive when empowered with better information. Teradata Autonomous Knowledge Platform activates enterprise intelligence by unifying data, knowledge and business context to achieve tangible outcomes. With Teradata, organizations can prov ...
📑 Job Title : Senior Engineer / Lead – DS+Gen AI Location : Chennai, Bangalore, Hyderabad Skills : Immediate Who we areTiger Analytics is a global leader in AI and analytics, he ...
📑 Job Title: Senior Zoho CRM Expert (AI, Integrations, Customization & BAU Support) Experience: 8–10 Years Job Type: Full-time Location: Remote / Hybrid / On-site (as applicable) Job Summary: We are looking for a highly experiencedSenior Zoho CRM E ...
📑 Sr. Data Engineer/Lead Data Engineer About the Role: Xtelify Ltd is looking for a Data Engineer to spearhead our Data Platform team. In this role, you will architect, scale, and oversee the deployment of mission-critical data pi ...
📑 About Ping CAPPing CAP is the company behind Ti DB, an open-source, distributed SQL database that handles some of the world’s most complex data scaling challenges. We are a team of builders, engineers, and creators who believe in the power of open-source and the future of cloud-native infrastructure. As we e ...
📑 The Marketing & Sales Ops Specialist is the operating backbone of BOT's go-to-market motion the person who makes pipeline run predictably and turns marketing activity into measurable revenue impact. This role owns the Hub Spot system of record, the lead-to-revenue process, ABM operations, and the reporting layer ...
📑 About Us Trevolution is a global leader in air ticketing and travel services, serving retail and corporate clients across 50+ markets. With over 20 years of expertise and a strong entrepreneurial mindset, we combine modern technology with a customer-first approach to simplify travel. ...
📑 Job Title: Lead Engineer – Security Operations Department: Engineering and Operations Location: Mumbai Reporting: Manager Security Operations Job Type: Full Time Shift: </strong ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimiz ...
📑 Job Description : Network Engineer, Corporate & Datacenter Location - Bangalore, India About the Role Network Engineer to design, deploy, and operate the corporate and datacenter network infrastructure that ...
📑 Our Company: At Teradata, we believe that people thrive when empowered with better information. Teradata Autonomous Knowledge Platform activates enterprise intelligence by unifying data, knowledge and business context to achieve tangible outcomes. With Teradata, organizations can prov ...
📑 Job Title : Senior Engineer / Lead – DS+Gen AI Location : Chennai, Bangalore, Hyderabad Skills : Immediate Who we areTiger Analytics is a global leader in AI and analytics, helpi ...
📑 Job Title: Senior Zoho CRM Expert (AI, Integrations, Customization & BAU Support) Experience: 8–10 Years Job Type: Full-time Location: Remote / Hybrid / On-site (as applicable) Job Summary: We are looking for a highly experiencedSenior Zoho CRM E ...
📑 Location: Noida / Chennai / Bangalore / Pune Experience: 10+ years Position Overview We are looking for a dynamic and client-focused Data & AI Presales Solution Architect who brings deep presales expertise combined w ...
📑 Location: India (Remote / Hybrid) Experience: ~14+ Years in Computational Engineering, Aero-thermal Sciences, and Scientific Machine Learning (SciML) Domain: Renewable Energy, Wind Turbine Aerodynamics, Aerospace Simulations <p ...
📑 Sr. Data Engineer/Lead Data Engineer About the Role: Xtelify Ltd is looking for a Data Engineer to spearhead our Data Platform team. In this role, you will architect, scale, and oversee the deployment of mission-critical data pi ...
📑 1. Position Summary The Data Engineering Lead is responsible for designing, building and operating data platforms and pipelines required for AI, analytics and automation use cases. The role leads a team of Data Engineers to implement the data architecture defined by the Architecture Lead and Solution A ...
📑 How You’ll Contribute As a Consultant Product Security, you will guide the organization in designing and implementing secure software development practices by collaborating with development, DevOps, and operations teams to embed security throughout every phase of the software develop ...
📑 Job Description : Network Engineer, Corporate & Datacenter Location - Bangalore, India About the Role Network Engineer to design, deploy, and operate the corporate and datacenter network infrastructure th ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, opti ...
📑 About the Job Experience: 7 -9 years Work Location: Bangalore/Hyderabad Designation: Module lead (Microsoft Fabric Data engineer) Role Description: We are l ...
📑 Job Title: Lead Engineer – Security Operations Department: Engineering and Operations Location: Mumbai Reporting: Manager Security Operations Job Type: Full Time Shift: </strong ...
📑 Location: India (Remote / Hybrid) Experience: ~14+ Years in Computational Engineering, Aero-thermal Sciences, and Scientific Machine Learning (SciML) Domain: Renewable Energy, Wind Turbine Aerodynamics, Aerospace Simulations </p ...
📑 About Us Trevolution is a global leader in air ticketing and travel services, serving retail and corporate clients across 50+ markets. With over 20 years of expertise and a strong entrepreneurial mindset, we combine modern technology with a customer-first approach to simplify travel. ...
📑 Job title: Senior Data Engineer (Airflow Specialist) Company: Hvantage Tech Solutions Pvt. Ltd. Department: Enterprise Applications / Healthcare IT Location: Remote / Hybrid / Onsite (as applicable) Emp ...
📑 About the Job Experience: 7 -9 years Work Location: Bangalore/Hyderabad Designation: Module lead (Microsoft Fabric Data engineer) Role Description: We are looking ...
📑 Avenue Code is the leading software consultancy focused on delivering end-to-end development solutions for digital transformation across every vertical. We’re privately held, profitable, and have been on a solid growth trajectory since day one. We care deeply about our clients, our partners, and our people. We p ...
📑 Company DescriptionCYFIRMA is a global leader in preemptive external threat landscape management, enabling organizations to predict and prevent cyberattacks through its AI-powered intelligence platform. By integrating nine pillars of external threat management including Attack Surface Discovery, Vulnerabilit ...
📑 Freelance/ Contract - Backend Developer:About the RoleWe are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimizing applicati ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimizing applic ...
📑 Freelance/ Contract - Backend Developer: About the Role We are seeking an experienced Backend Developer to support the development, enhancement, and maintenance of enterprise-grade software applications. This role focuses on building scalable backend systems, optimizing applic ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 The Enterprise Advanced team is a diverse group of individuals across Europe and India who develop software to run MongoDB on any type of infrastructure at global scale. Our software and services allow users to deploy fault-tolerant, globally distributed MongoDB clusters in minutes.The main focus of th ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 The OpportunityAre you a customer-centric professional with a strong technical aptitude and exceptional communication skills, eager to take on the challenges of managing relationships with clients in a dynamic environment? If so, you would want to join our team as a Senior Technical Account ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
📑 About Reboot MonkeyReboot Monkey is a global datacenter services provider headquartered in Haarlem, Netherlands, operating 24 green-powered facilities across 6 continents. We deliver colocation, IP transit, smart hands, remote hands, and managed d ...
Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.
The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.
Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.
The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.
Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 1,069,301+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.
Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:
Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.
The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.
The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.
Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.
The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.
Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.
There is a wide range of job opportunities in India such as:
| Work model | Country |
|---|---|
| Full-Time | India |
| Part-Time | India |
| Remote | India |
| Internship | India |
| Contract | India |
The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.
Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.
Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:
| Job title | Company | Work model |
|---|---|---|
| Manager- Data Engineering | Glenmark Pharmaceuticals | Full-time |
| Data & AI Presales Solution Architect | HCLTech | Full-time |
| Senior Consultant - Tech Consulting... | WomenTech Network | Full-time |
| Artificial Intelligence Engineer | Teradata | Full-time |
| Data Scientist | Tiger Analytics | Full-time |
| Senior Zoho CRM Expert (AI,... | DBiz.ai | Full-time |
| Data Engineer (3-7 Years) | Airtel Digital | Full-time |
| Senior marketing manager, india | TiDB, Powered By PingCAP | Full-time |
| Marketing and sales ops specialist | BOT Consulting | Full-time |
| Technical Lead | Trevolution Group | Full-time |
Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!