909,878+ Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India — Top Companies Hiring June 2026

     
  Reset

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead) Everstage · Growth & Brand Team: Growth & Brand Reports to: SVP, Growth & Brand Location: Hybrid - Bangalore or Chennai Experience: 5-7 years <p ...

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead) Everstage · Growth & Brand Team: Growth & Brand Reports to: SVP, Growth & Brand Location: Hybrid - Bangalore or Chennai Experience: 5-7 years <p ...

Cloud Infrastructure & DevOps Engineer | AWS, Kubernetes & Automation

📑 Job Summary Synechron is seeking an experienced SRE-DevOps Engineer to lead the design, deployment, and management of scalable, reliable, and secure infrastructure supporting enterprise cloud and application environments. This role involves collaborating with cross-functional teams to develop a ...

Cloud Infrastructure & DevOps Engineer | AWS, Kubernetes & Automation

📑 Job Summary Synechron is seeking an experienced SRE-DevOps Engineer to lead the design, deployment, and management of scalable, reliable, and secure infrastructure supporting enterprise cloud and application environments. This role involves collaborating with cross-functional teams to develop a ...

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead) Everstage · Growth & Brand Team: Growth & Brand Reports to: SVP, Growth & Brand Location: Hybrid - Bangalore or Chennai Experience: 5-7 years <p ...

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead) Everstage · Growth & Brand Team: Growth & Brand Reports to: SVP, Growth & Brand Location: Hybrid - Bangalore or Chennai Experience: 5-7 years <p ...

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead) Everstage · Growth & Brand Team: Growth & Brand Reports to: SVP, Growth & Brand Location: Hybrid - Bangalore or Chennai Experience: 5-7 years <p ...

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead) Everstage · Growth & Brand Team: Growth & Brand Reports to: SVP, Growth & Brand Location: Hybrid - Bangalore or Chennai Experience: 5-7 years <p ...

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead) Everstage · Growth & Brand Team: Growth & Brand Reports to: SVP, Growth & Brand Location: Hybrid - Bangalore or Chennai Experience: 5-7 years <p ...

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead) Everstage · Growth & Brand Team: Growth & Brand Reports to: SVP, Growth & Brand Location: Hybrid - Bangalore or Chennai Experience: 5-7 years <p ...

AI Inference Engineer QVAC (100% remote Worldwide)

📑 Join Tether and Shape the Future of Digital FinanceAt Tether, we’re not just building products, we’re pioneering a global financial revolution. Our cutting-edge solutions empower businesses—from exchanges and wallets to payment processors and ATMs—to seamlessly integrate reser ...

Software Development Engineer 2

📑 WHAT YOU DO AT AMD CHANGES EVERYTHINGAt AMD, our mission is to build great products that accelerate next-generation computing experiences—from AI and data centers, to PCs, gaming and embedded systems. Grounded in a culture of innovation and collaboration, we believe real progress comes ...

QA Analyst II DaWinci (Hybrid in Pune)

📑 QA Analyst II - DaWinciLocation: Pune, India Model of Work: HybridAbout Quorum SoftwareQuorum Software connects people and information across the energy value chain. Twenty years ago, we built the first software for gas plant accountants. Pipeline operat ...

GIS Specialist II

📑 Job DescriptionAs a GIS Consultant/Analyst, you will apply your knowledge of Geographic Information Systems (GIS), spatial data and database management to support the delivery of a diverse range of projects. Using the Esri technology stack (mobile, desktop and web), alongside ETL ...

Senior Developer / Developer (Java, Go, Kotlin, Dot Net), SAP Concur

📑 We help the world run betterAt SAP, we keep it simple: you bring your best to us, and we'll bring out the best in you. We're builders touching over 20 industries and 80% of global commerce, and we need your unique talents to help shape what's next. The work is challenging – but it matters. You'll ...

AI Engineer

📑 Job DescriptionRole SummaryWe are looking for a hands-on AI Engineer with strong expertise in Generative AI and Agentic AI systems, focused on building and operating production-grade applications.The ideal candidate must have practical experience design ...

Cloud Infrastructure & DevOps Engineer | AWS, Kubernetes & Automation

📑 Job SummarySynechron is seeking an experienced SRE-DevOps Engineer to lead the design, deployment, and management of scalable, reliable, and secure infrastructure supporting enterprise cloud and application environments. This role involves collaborating with cross-functional teams to develop aut ...

Senior Elastic ML & Gen AI Engineer

📑 Who We AreAt Kyndryl, we run and reimagine the mission-critical technology systems that drive advantage for the world’s leading businesses. We are at the heart of progress; with proven expertise and a continuous flow of AI-powered insight, enabling smarter decisions, faster innovation, and a las ...

Technical Lead, Software Engineer (OOPs, C#, JavaScript, ASP.NET, MVC, EF, WebAPI/Rest API, React, IIS, SQL)

📑 JOB DESCRIPTION As a Technical Lead, Software Engineering embedded in an energetic web application agile team of Software and QA Engineers, you will lead the team in creating web application software products utilizing state-of-the-art technologies. You will be hands-on, involved in designing Web appli ...

Cloud Infrastructure & DevOps Engineer | AWS, Kubernetes & Automation

📑 Job SummarySynechron is seeking an experienced SRE-DevOps Engineer to lead the design, deployment, and management of scalable, reliable, and secure infrastructure supporting enterprise cloud and application environments. This role involves collaborating with cross-functional teams to develop aut ...

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead) Everstage · Growth & Brand Team: Growth & Brand Reports to: SVP, Growth & Brand Location: Hybrid - Bangalore or Chennai Experience: 5-7 years About Everstage Everstage is the l ...

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead) Everstage · Growth & Brand Team: Growth & Brand Reports to: SVP, Growth & Brand Location: Hybrid - Bangalore or Chennai Experience: 5-7 years About Everstage Everstage is the l ...

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead) Everstage · Growth & Brand Team: Growth & Brand Reports to: SVP, Growth & Brand Location: Hybrid - Bangalore or Chennai Experience: 5-7 years <p ...

AI Engineer

📑 Job DescriptionRole SummaryWe are looking for a hands-on AI Engineer with strong expertise in Generative AI and Agentic AI systems, focused on building and operating production-grade applications.The ideal candidate must have practical experience design ...

AI Inference Engineer QVAC (100% remote Worldwide)

📑 Join Tether and Shape the Future of Digital FinanceAt Tether, we’re not just building products, we’re pioneering a global financial revolution. Our cutting-edge solutions empower businesses—from exchanges and wallets to payment processors and ATMs—to seamlessly integrate reser ...

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead)Everstage · Growth & BrandTeam: Growth & Brand Reports to: SVP, Growth & BrandLocation: Hybrid - Bangalore or Chennai Experience: 5-7 yearsAbout EverstageEverstage is the leading sales ...

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead) Everstage · Growth & Brand Team: Growth & Brand Reports to: SVP, Growth & Brand Location: Hybrid - Bangalore or Chennai Experience: 5-7 years About Everstage Everstage is the l ...

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead) Everstage · Growth & Brand Team: Growth & Brand Reports to: SVP, Growth & Brand Location: Hybrid - Bangalore or Chennai Experience: 5-7 years About Everstage Everstage is the l ...

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead) Everstage · Growth & Brand Team: Growth & Brand Reports to: SVP, Growth & Brand Location: Hybrid - Bangalore or Chennai Experience: 5-7 years About Everstage Everstage is the l ...

Product Manager, Website (Lead)

📑 Product Manager, Website (Lead)Everstage · Growth & BrandTeam: Growth & Brand Reports to: SVP, Growth & BrandLocation: Hybrid - Bangalore or Chennai Experience: 5-7 yearsAbout EverstageEverstage is the leading sales ...

Senior Enterprise Software Engineer (JD Edwards)

📑 POSITION OVERVIEWWe are seeking a highly accomplished, hands-on Senior Lead Operations Manager to join our enterprise technology leadership team. This pivotal role blends deep technical execution with strategic leadership across four core disciplines: JD Edwards EnterpriseOne (JDE E1), IBM Integ ...

Sap Basis Security Consultant

📑 Position: SAP Basis Senior Consultant Experience: 5–7 Years Location: Pune / Remote Job Summary: SAP Pune DC is hiring a skilled SAP Basis Senior Consultant to manage and guide a team of 10–15 L1 & L2 consultants across shifts. The role invol ...

Sap Basis Security Consultant

📑 Position: SAP Basis Senior Consultant Experience: 5–7 Years Location: Pune / Remote Job Summary: SAP Pune DC is hiring a skilled SAP Basis Senior Consultant to manage and guide a team of 10–15 L1 & L2 consultants across shifts. The role invol ...

Sap Basis Security Consultant

📑 Position: SAP Basis Senior Consultant Experience: 5–7 Years Location: Pune / Remote Job Summary: SAP Pune DC is hiring a skilled SAP Basis Senior Consultant to manage and guide a team of 10–15 L1 & L2 consultants across shifts. The role invol ...

Data Engineer

📑 At VIDA we’re building the future of digital identity. As a Data Engineer you’ll work across the stack—from platform and infrastructure to data pipelines and end-user tooling. You’ll help us modernize our batch ETLs and lead our push into streaming and real-time fraud detection . We run on AWS and make extensive ...

Sap Basis Security Consultant

📑 Position: SAP Basis Senior Consultant Experience: 5–7 Years Location: Pune / Remote Job Summary: SAP Pune DC is hiring a skilled SAP Basis Senior Consultant to manage and guide a team of 10–15 L1 & L2 consultants across shifts. The role invol ...

Sap Basis Security Consultant

📑 Position: SAP Basis Senior Consultant Experience: 5–7 Years Location: Pune / Remote Job Summary: SAP Pune DC is hiring a skilled SAP Basis Senior Consultant to manage and guide a team of 10–15 L1 & L2 consultants across shifts. The role invol ...

Sap Basis Security Consultant

📑 Position: SAP Basis Senior ConsultantExperience: 5–7 YearsLocation: Pune / RemoteJob Summary:SAP Pune DC is hiring a skilled SAP Basis Senior Consultant to manage and guide a team of 10–15 L1 & L2 consultants across shifts. The role involves end-t ...

Sap Basis Security Consultant

📑 Position: SAP Basis Senior ConsultantExperience: 5–7 YearsLocation: Pune / RemoteJob Summary:SAP Pune DC is hiring a skilled SAP Basis Senior Consultant to manage and guide a team of 10–15 L1 & L2 consultants across shifts. The role involves end-t ...

Sap Basis Security Consultant

📑 Position: SAP Basis Senior ConsultantExperience: 5–7 YearsLocation: Pune / RemoteJob Summary:SAP Pune DC is hiring a skilled SAP Basis Senior Consultant to manage and guide a team of 10–15 L1 & L2 consultants across shifts. The role involves end-t ...

Sap Basis Security Consultant

📑 Position: SAP Basis Senior Consultant Experience: 5–7 Years Location: Pune / Remote Job Summary: SAP Pune DC is hiring a skilled SAP Basis Senior Consultant to manage and guide a team of 10–15 L1 & L2 consultants across shifts. The role invol ...

Sap Basis Security Consultant

📑 Position: SAP Basis Senior Consultant Experience: 5–7 Years Location: Pune / Remote Job Summary: SAP Pune DC is hiring a skilled SAP Basis Senior Consultant to manage and guide a team of 10–15 L1 & L2 consultants across shifts. The role invol ...

Ai Architect

📑 We are looking for an experienced AI Architect to lead the design and implementation of AI-driven solutions across enterprise platforms. This role is critical to the formation and success of the AI Guild and will involve both strategic planning and hands-on development.Job Title: AI Architect < ...

Job Description: Data Engineer (Retail & CPG)

📑 Job Description: Data Engineer (Retail & CPG) · Experience: 5–7 Years (Heavy Hands-on) · Location: India (Hybrid) – Bangalore/Hyderabad/Others · Domain: Retail & Consumer Packaged Goods (CPG) Role Overview We are looking for a powerhouse Senior Data Engineer with 5 to 7 year ...

Retail Data Pipeline Developer

📑 Job Description: Data Engineer (Retail & CPG)· Experience: 5–7 Years (Heavy Hands-on)· Location: India (Hybrid) – Bangalore/Hyderabad/Others· Domain: Retail & Consumer Packaged Goods (CPG)Role OverviewWe are looking for a powerhouse Senior Data Engineer with 5 to 7 years of ...

Manager marketing adtech

📑 Designation: Senior Manager / Manager - Marketing Location : Gurugram Position Description The position based in India to oversee the Asia Pacific region. In this position, you will be in charge of maintaining and strengthening the company's brand positioning across India, Indonesia ...

Sap Basis Security Consultant

📑 Position: SAP Basis Senior Consultant Experience: 5–7 Years Location: Pune / Remote Job Summary: SAP Pune DC is hiring a skilled SAP Basis Senior Consultant to manage and guide a team of 10–15 L1 & L2 consultants across shifts. The role invol ...

Sap Basis Security Consultant

📑 Position: SAP Basis Senior Consultant Experience: 5–7 Years Location: Pune / Remote Job Summary: SAP Pune DC is hiring a skilled SAP Basis Senior Consultant to manage and guide a team of 10–15 L1 & L2 consultants across shifts. The role invol ...

Sap Basis Security Consultant

📑 Position: SAP Basis Senior ConsultantExperience: 5–7 YearsLocation: Pune / RemoteJob Summary:SAP Pune DC is hiring a skilled SAP Basis Senior Consultant to manage and guide a team of 10–15 L1 & L2 consultants across shifts. The role involves end-t ...



Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Job Search Guide, Trends and Insights

Real-Time Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs Category Trends (Graphical Representation)

Expertini presents the current leading trends in job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Our interactive graphical representation below showcases these trends, helping you stay informed about the job market dynamics in India. Evaluate the data to understand the employment landscape and make informed career or hiring decisions.

The first graph of job trends uses a bar chart to display the popularity of various job categories for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each bar represents a different job category, with the size of the bar indicating the number of jobs available in that category. This visual representation highlights key areas of employment, showing the concentration and distribution of job opportunities across different categories.

Management
0
Business And Financial Operations
0
Computer And Mathematical
0
Architecture And Engineering
0
Life Physical And Social Science
0
Community And Social Service
0
Legal
0
Educational Instruction And Library
0
Arts Design Entertainment Sports And Media
0
Healthcare Practitioners And Technical
0
Healthcare Support
0
Protective Service
0
Food Preparation And Serving Related
0
Building And Grounds Cleaning And Maintenance
0
Personal Care And Service
0
Sales And Related
0
Office And Administrative Support
0
Farming Fishing And Forestry
0
Construction And Extraction
0
Installation Maintenance And Repair
0
Production
0
Transportation And Material Moving
0
Military Specific
0
Other General
0
Download Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs in India Categories Trends

Uncover Live Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Job Type Trends (Graphical Representation)

Exploring the employment landscape by delving into the diverse array of job types shaping its economic fabric is an important aspect of your job search. It is one of the keys to navigating a dynamic job market.

The second graph of job type uses a bar chart to display the trends in various job types for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs in India. Each section of the bar represents a different job type (full-time, part-time, contract, internship, and remote), providing a clear visual representation of the distribution and popularity of each type within the job market. This allows for easy comparison of the prevalence of different employment types over time, helping to understand the job market dynamics.

How to Find the Best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Finding the best Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs involves using online job portals, networking, and tailoring your resume to highlight relevant skills and experiences. Platforms like Expertini can streamline your job search by providing access to numerous job listings. Launch your Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India! Explore 909,878+ number of available Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs exciting opportunities and find your perfect fit. Apply for FREE on Expertini, the leading job board since 15+ years.

Effective Job Search Tips for Landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

Enhance your chances of landing Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting jobs by following these effective job search tips. Utilize India Jobs Expertini to find the right job and improve your prospects with features like Resume Scoring and personalized job alerts. Expertini also offers a mobile app for on-the-go job searching and alerts. Additionally, consider these tips:

  • ➵ Stay focused on your job search goals.
  • ➵ Be attentive to market trends and job openings.
  • ➵ Customize your resume for each appspancation.
  • ➵ Prepare thoroughly for interviews.
  • ➵ Network with professionals in your field.

Is a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Career Right for You?

Determine if a Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting career in India aligns with your career goals. Consider factors like job satisfaction, career growth, and work-life balance.

Industries Hiring the Most Professionals

The key industries and job sectors in India are known for their diverse economic landscape, with opportunities in sectors such as technology, healthcare, finance, and more. This can help you focus your job search on sectors with high demand.

Average Salary Range for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Roles

The average salary range for your role varies, but the standard pay scale is rated "Standard" for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting within India. Salary levels may vary depending on your industry, experience, and skills, so it's essential to research and negotiate effectively. Knowing the salary expectations can help you negotiate better job offers.

Cost of Living in India vs. Other Cities

Compare the cost of living in India to other cities in India. Expertini calculates it based on the percentage of earnings to living costs, with an average ranging from 33% to 65% of your monthly income. This comparison can help you make informed decisions about your financial planning and lifestyle. It's also advisable to check with locals before moving to a new town.

Popular Job Boards & Recruiters for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Jobs

The working professional life in India is rated good within our internally formulated rating system. The working hours, work-life balance, and overall work environment are rated favorably, providing a sense of what to expect as a professional. Insights into the workplace environment, values, and expectations can be well understood by exploring the available job listing opportunities. Understanding the work culture can help you thrive in your professional journey. This knowledge can help you find a workplace that matches your values and work style.

Get Personalized Job Alerts

Sign Up for personalized job alerts on Expertini to receive notifications about new Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job openings in India. This ensures you stay updated and can apply promptly to relevant opportunities. We provide customized job alerts, available daily, weekly, and monthly.

Types of Jobs Available in India?

There is a wide range of job opportunities in India such as:

Work model Country
Full-Time India
Part-Time India
Remote India
Internship India
Contract India

The available jobs vary across industries and sectors, providing options for professionals with different skills and interests. Understanding the various roles can help you target your job search more effectively.

Top Companies Hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting Positions

Many top companies that are actively hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting positions. Leveraging resources like Expertini can help you identify these companies and apply for roles that match your skills and career goals.

Here is the List of Top Companies that are currently hiring for Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting:

Job title Company Work model
Product Manager, Website (Lead) Everstage Full-time
Product Manager, Website (Lead) Everstage Full-time
Cloud Infrastructure & DevOps... Synechron Full-time
Cloud Infrastructure & DevOps... Synechron Full-time
Product Manager, Website (Lead) Everstage Full-time
Product Manager, Website (Lead) Everstage Full-time
Product Manager, Website (Lead) Everstage Full-time
Product Manager, Website (Lead) Everstage Full-time
Product Manager, Website (Lead) Everstage Full-time
Product Manager, Website (Lead) Everstage Full-time

Your ideal job search starts here! Explore thousands of Full Stack Developerreactangularawsbackendbrowsercssdatadesignengineeringfigmagraphqlplatformprojectrdsreactrestsedtestuiwebwriting job opportunities across India. Whether you're seeking full-time, part-time, remote, or internship positions, Expertini has you covered. Our extensive listings feature roles from top companies nationwide, ensuring you find the perfect fit for your skills and career aspirations. Start your journey to a fulfilling career today with Expertini – your trusted partner in job searching!